SecReT6
Protein ID: 384419468
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2542
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2587887..2588390 [-]
Producthypothetical protein
NoteTssD
UniProt IDG7TGR6
KEGG IDxor:XOC_2542
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.40E-36, Aligned region: 7..141
Protein Sequence: 167 a.a.     [Download]
>gi|384419468|ref|YP_005628828.1| hypothetical protein XOC_2542 [Xanthomonas oryzae pv. oryzicola BLS256]
MAFDMHLKFGSGDVEIKGASNHAKHKDQVPIIAWSWGTSNTGNLHTGAGYAAGGKANVKDISITKYVDSC
SNALLNACCTGARVDSATLYVTNATGEQSDYVTIELSEGVMITSVSTGGSGGEDRLTENVTLHFGKFKYS
FQPQDDKGKKQGGTKDFTFNMQEVKKS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2588390-2587887 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGCTTTCGATATGCATCTCAAATTCGGCTCGGGCGACGTCGAGATCAAGGGCGCGTCCAACCATGCCA
AGCACAAGGACCAAGTGCCGATCATTGCCTGGTCGTGGGGCACCAGCAATACCGGCAACCTGCATACCGG
CGCCGGGTATGCAGCCGGCGGCAAGGCCAATGTGAAGGATATTTCCATCACCAAGTACGTCGATAGTTGC
TCCAATGCCTTGCTCAACGCCTGCTGCACGGGTGCGCGTGTGGATTCGGCCACGCTGTACGTCACCAACG
CCACCGGCGAGCAGTCGGACTACGTGACGATCGAACTCAGCGAAGGCGTGATGATCACCTCGGTGTCCAC
CGGCGGTAGCGGTGGCGAGGACCGTCTGACCGAAAACGTGACCCTGCATTTCGGCAAGTTCAAGTATTCG
TTCCAGCCGCAGGACGACAAGGGCAAGAAGCAGGGCGGCACCAAGGACTTCACGTTCAACATGCAGGAAG
TGAAGAAGTCCTGA