SecReT6
Protein ID: 384419469
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2543
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2588490..2589992 [-]
ProductSciI protein
NoteTssC
UniProt IDG7TGR7
KEGG IDxor:XOC_2543
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.30E-194, Aligned region: 69..495
Protein Sequence: 500 a.a.     [Download]
>gi|384419469|ref|YP_005628829.1| SciI protein [Xanthomonas oryzae pv. oryzicola BLS256]
MATQHSAAQDLADAQPQTSQTDDFAALLTREFRPRSERAGEEVRLAVRTLAEQVLERSDIISDDLAQTIN
AYVAEIDRKISEQLNLILHAPQFQALEGAWRGLHYLVSNTESDTQLKIRVLNVSKRELAKNLKRFKGTAW
DQSPVFKKIYEAEYGQLGGEPYGCLIGDYHFDHSPQDVDTLRGISQIAAASHAPFIAAAGPGLMGMESWS
ELSNPRDLAKIFSTPDYAAWRSLRQSEDAKYLALAMPRTLARLPYGAKTDPVEAFDFEEDTQGADSSRYT
WQNAAYAMAVNINRSFKQYGWCTRIRGVESGGAVEGLPTHTFPADDGGVDMKCPTEVAITDRRSAELDKM
GLMPLVHRKNTDMAAFISAQSLGKPEEYDDPDATANAALSARLPYMFACCRFAHYLKCIVRDKIGSFSTR
QQMQSWLTDWVMNYVDGDPANSSEETKARKPLAAAEVVVEEVEGNPGYYTSKFFLRPHYQLEGLTVSLRL
VSRLPSAQAA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2589992-2588490 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGCGACCCAACATTCCGCTGCCCAAGATCTCGCCGACGCGCAGCCGCAAACCAGTCAGACCGACGACT
TTGCGGCCCTGCTGACCCGCGAATTCCGTCCGCGTAGCGAACGCGCCGGCGAAGAAGTGCGGTTGGCTGT
GCGCACCTTGGCCGAACAGGTGCTGGAACGCAGCGACATCATCAGCGACGACCTCGCGCAGACAATCAAC
GCGTATGTCGCCGAGATCGACCGCAAGATCAGCGAGCAACTCAACCTCATCCTGCACGCCCCGCAATTCC
AGGCGCTGGAGGGTGCATGGCGCGGACTGCATTATCTGGTCAGCAACACCGAATCGGACACGCAGTTGAA
GATCCGCGTGCTCAACGTGTCCAAAAGGGAGCTCGCCAAGAACCTCAAGCGCTTCAAGGGCACCGCCTGG
GACCAGAGCCCGGTATTCAAGAAAATTTACGAAGCCGAGTACGGCCAGCTGGGTGGCGAACCCTACGGCT
GTTTGATTGGCGATTACCACTTCGACCATAGCCCGCAGGATGTCGACACGCTGCGCGGCATCAGCCAGAT
TGCCGCCGCCTCGCATGCGCCCTTCATCGCCGCTGCGGGTCCTGGCCTGATGGGGATGGAAAGCTGGAGC
GAGCTGTCCAACCCGCGCGATCTGGCCAAGATTTTTTCTACCCCCGATTACGCGGCTTGGCGTTCGTTGC
GTCAGAGCGAGGATGCCAAGTACCTGGCGCTCGCCATGCCGCGCACGCTGGCGCGGCTGCCGTACGGAGC
CAAGACCGATCCGGTGGAAGCGTTCGACTTCGAAGAAGACACCCAGGGCGCCGATTCGTCGCGCTACACC
TGGCAAAACGCCGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCAGTACGGTTGGTGCACCC
GCATTCGCGGCGTGGAGTCGGGTGGGGCGGTGGAAGGCCTGCCGACGCATACCTTCCCGGCCGACGATGG
CGGTGTGGACATGAAGTGCCCGACCGAGGTCGCGATTACCGACCGCCGTTCGGCCGAACTCGACAAGATG
GGTCTGATGCCGCTGGTACATCGCAAGAACACCGACATGGCAGCCTTCATCAGCGCGCAGTCGTTGGGCA
AGCCCGAGGAATACGACGACCCGGATGCCACCGCCAACGCGGCGCTGAGCGCACGCCTGCCGTATATGTT
CGCTTGCTGCCGCTTCGCGCACTATTTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAGCACGCGC
CAGCAGATGCAGAGCTGGTTGACCGATTGGGTGATGAACTACGTCGACGGCGACCCGGCCAATTCCAGCG
AAGAAACCAAGGCGCGTAAGCCATTGGCTGCTGCCGAAGTGGTCGTCGAAGAGGTCGAGGGCAACCCCGG
CTACTACACCTCCAAGTTCTTCCTGCGCCCGCATTACCAGCTCGAAGGCCTGACGGTATCGCTACGCCTG
GTCTCGCGCTTGCCATCGGCGCAGGCAGCCTGA