SecReT6
Protein ID: 384419470
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2544
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2589997..2590632 [-]
Producthypothetical protein
NoteTssB
UniProt IDG7TGR8
KEGG IDxor:XOC_2544
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.60E-55, Aligned region: 54..207
Protein Sequence: 211 a.a.     [Download]
>gi|384419470|ref|YP_005628830.1| hypothetical protein XOC_2544 [Xanthomonas oryzae pv. oryzicola BLS256]
MPVFDFIPPAAAHTMHLRCKGDAFATWPLQPQRPATTQIIGGRMSVRSSSQKFIARNRAPRVQIEYDVEI
YGSQKKVQVPFVMGVLSDLSGANTEHLPALEAREAVEMDVDNFDSRLRAMQPRVAMSVSNTLTGSGELPV
DITFDSLDDFSPTAVVKKVAPLAELLEARTQLANLGTYLDGKAGAERLIADAIKDPTLLRSLVAAPKSKD
A
 
Nucleotide Sequence: 636 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2590632-2589997 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGCCGGTGTTCGATTTCATTCCGCCGGCAGCAGCGCACACGATGCATCTGCGGTGCAAGGGGGACGCCT
TTGCCACATGGCCGCTGCAACCGCAGCGTCCAGCAACCACGCAGATCATCGGAGGCCGCATGTCCGTTCG
CAGCAGCAGTCAGAAGTTCATTGCCAGAAATCGCGCGCCTCGCGTGCAGATCGAGTACGACGTCGAGATC
TACGGCTCGCAGAAAAAGGTGCAGGTTCCGTTCGTCATGGGTGTGTTGTCGGATCTGTCCGGCGCCAATA
CCGAACACCTGCCGGCGCTGGAAGCACGCGAGGCAGTGGAAATGGATGTCGACAATTTCGACAGCCGGCT
GCGTGCCATGCAACCGCGCGTGGCCATGAGCGTTTCCAATACGCTCACCGGCAGCGGCGAGTTACCGGTC
GATATCACCTTCGACAGCCTGGACGATTTTTCGCCCACCGCGGTCGTGAAAAAGGTGGCACCGCTGGCCG
AGCTGCTGGAAGCACGTACCCAGCTGGCCAATCTAGGCACTTACCTTGACGGCAAAGCCGGCGCCGAGCG
CTTGATCGCCGATGCGATCAAGGATCCCACCCTGCTGCGTTCGCTGGTCGCGGCTCCCAAGTCGAAGGAT
GCGTAA