SecReT6
Protein ID: 384419471
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2545
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2591104..2593866 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG7TGR9
KEGG IDxor:XOC_2545
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.00E-72, Aligned region: 41..355
DUF2345 [PF10106], Evalue: 8.40E-38, Aligned region: 723..886
T6SS_Vgr [PF13296], Evalue: 5.20E-27, Aligned region: 293..323
T6SS_Vgr [PF13296], Evalue: 5.20E-27, Aligned region: 579..683
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 225..250
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 434..537
Protein Sequence: 920 a.a.     [Download]
>gi|384419471|ref|YP_005628831.1| Rhs element Vgr protein [Xanthomonas oryzae pv. oryzicola BLS256]
MDPVATVLSALSAAPHQQERLLRLHTPLGPDVLVAETLDGRESVDGGGFRFDVGALSANAGLPLDDLLGQ
PVLLELLTAESRTALRPFHGHVTAFERLGSNGGLARYRLVVEPWLALLAQRVDSYVFQDMSVVEIAESVF
ADYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAFLSRLLAEEGIAYWFEHTGAADSDTRGTHTLV
LSDHNAAFADLGTVRYHRTDVTEQQDSVQQWVQAHRWRATSLSRASWDYRSRSLRLAGAEGTPLGDIGAE
DVDTAGPYGWQDSTRGQRRAQQHLDAQQVTAQTIQGQGTWRQLAPGTRFGLRQHAGVAADAAFLCLQVRH
QARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYVPAQDEAAVEFYRNQFTAIPATATYRPQTED
GHGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWV
RVMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIGSVYNGRGQDDAAHNQVGGGGAGATGNAPAWF
QGNAHGAVFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQLSTTQHASSLTLGHLKGGHDNLREGERG
YGADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGALSQLQQGSDLLKRLNDAARTQQAGLPSEPESLPTQ
DGLKTLQDHLQATHSGSAAGAIGGGAGEVPGWSAPVLLGSGQAGVMSLTPADQVWVSGTQTALLAGSALN
WLSQGHLVLAVAGGLVLYTQGSDPVAGSPNQERGIALHAAQGTLSARAHRSTATLAAKTQVRIVSTTADV
QLAAPTKHLLATAAGAYIKLDGDDIELGAPGVVAFKGGQQVLTGPQGASMSTVTPSASHKLCEYTARAAD
FAGAGTMGAA
 
Nucleotide Sequence: 2763 bp     [Download]
>gi|384417079|ref|NC_017267.1|:2591104-2593866 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGACCCGGTCGCCACAGTACTTTCCGCCCTCAGCGCCGCCCCGCACCAGCAAGAACGCCTGCTGCGGT
TGCACACCCCGCTGGGCCCCGACGTGCTGGTTGCCGAGACCCTGGATGGCCGCGAGTCGGTCGATGGCGG
CGGCTTCCGTTTCGACGTGGGCGCACTATCGGCCAACGCCGGCTTGCCGCTGGACGACCTGCTCGGCCAG
CCGGTGCTGCTGGAACTGCTCACCGCCGAGTCGCGCACCGCGCTGCGCCCGTTCCACGGCCATGTCACCG
CGTTCGAGCGGCTCGGCAGCAACGGCGGCCTGGCGCGCTACCGGCTGGTGGTGGAGCCGTGGCTGGCGCT
GCTGGCCCAGCGCGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTC
GCCGACTACGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACG
CCAGGCGCAGCCTGACCACGCAATACGAAGAGACCGACTTCGCGTTCCTGAGCCGGCTGCTGGCCGAGGA
AGGCATCGCCTATTGGTTCGAGCACACTGGCGCAGCCGACAGCGATACGCGCGGCACGCACACGCTGGTG
CTGTCGGACCATAACGCCGCCTTCGCCGACCTGGGCACGGTGCGCTACCACCGCACCGACGTCACCGAGC
AGCAGGACAGCGTGCAGCAGTGGGTACAGGCACATCGCTGGCGCGCGACCAGTCTGTCGCGGGCCAGCTG
GGACTACCGCAGCCGCAGCCTGCGCCTGGCCGGCGCCGAAGGCACGCCGCTGGGCGACATCGGTGCCGAG
GACGTGGACACCGCCGGCCCGTACGGCTGGCAGGACAGCACCCGTGGCCAGCGCCGCGCGCAGCAGCATC
TGGATGCGCAGCAGGTGACGGCGCAGACCATCCAGGGCCAGGGGACCTGGCGGCAACTGGCACCGGGCAC
GCGTTTCGGGCTGCGCCAGCATGCGGGCGTGGCGGCCGATGCGGCGTTCCTGTGCCTGCAGGTGCGGCAC
CAGGCGCGCAACAATCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGGCGCGGTGGCGGTGG
CCGGCGCGCCGCTGCCGCCGGCGCTGGCAGGCCTGAGCGGCGGATATGTGCCGGCGCAGGATGAGGCGGC
GGTAGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGCCGCAAACCGAGGAC
GGCCACGGCGTGCGCCTGCATCCCAAGCCAACGGTCGTCGGCACGCTGAGCGCGATCGTGGTCAGCGACG
GCGACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAGCGCGGGGCCGACGC
CAGCAGCGCGCTGGCGCATCCGGGGGGCGAGGACAACGCGCCGGGCAGTGCCTCGGCGTGGACCTGGGTG
CGGGTGATGACGCCGTGGGCCGGGGACAACTGGGGCGGCGTGGTGCTGCCGCGCAAGGGCCAGGAAGTGC
TGGTGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCAGCGTGTACAACGGGCGCGGCCA
GGACGACGCGGCGCACAACCAGGTCGGCGGCGGCGGGGCCGGAGCCACCGGCAATGCGCCGGCGTGGTTC
CAGGGCAACGCGCACGGCGCGGTGTTCACCGGGTTCAAGAGCCAGGCGCTGGCGCAGAGCCAGGACGGCA
CCGGCGGCTACCAGCAGCTGCGGCTGGACGACACGCCCGGCCAGGGCCGCGCGCAGCTGTCGACCACCCA
GCACGCCAGCAGCTTGACCCTGGGCCACCTGAAGGGCGGCCACGACAACCTGCGCGAAGGCGAGCGCGGG
TACGGGGCGGACCTGTCCACGCAGGCCTACGGCGCGGTGCGCGCCGGCCAGGGCCTGCTGCTGAGCAGCG
AACCGGGCAACACCCAACTGGCCGCCACCGGCGCGCTGAGCCAACTGCAGCAGGGCAGCGACCTGCTCAA
GCGCCTCAACGACGCCGCCCGCACCCAGCAGGCGGGCCTACCGAGCGAACCGGAGTCCCTGCCGACCCAG
GACGGCCTGAAGACCTTGCAGGACCACCTGCAGGCCACCCACAGCGGCAGCGCGGCCGGCGCGATCGGCG
GTGGTGCCGGCGAGGTGCCCGGCTGGAGCGCCCCAGTGCTGCTGGGCAGCGGCCAGGCCGGCGTGATGAG
CCTGACCCCGGCCGACCAGGTGTGGGTCTCGGGCACCCAGACCGCGCTGCTGGCCGGCAGCGCACTGAAC
TGGCTCAGCCAGGGCCACCTGGTGCTGGCGGTGGCCGGCGGGCTGGTGCTGTACACCCAGGGCAGCGACC
CGGTCGCCGGCAGCCCCAACCAGGAGCGCGGCATCGCCCTGCACGCCGCGCAAGGCACGCTCAGCGCCCG
CGCGCACAGGAGCACCGCCACCCTGGCCGCCAAGACCCAGGTGCGCATCGTCAGCACCACCGCCGACGTC
CAGCTCGCCGCGCCGACCAAGCACCTGCTGGCCACCGCAGCCGGCGCCTACATCAAGCTGGACGGCGACG
ACATCGAACTGGGCGCGCCGGGGGTGGTCGCGTTCAAGGGCGGGCAGCAGGTGTTGACCGGGCCGCAGGG
GGCATCCATGAGCACCGTGACGCCATCCGCCAGCCACAAGCTGTGTGAATACACCGCCCGCGCGGCAGAT
TTCGCCGGTGCAGGGACGATGGGGGCCGCCTGA