SecReT6
Protein ID: 384422627
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0095
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]114221..114727 [+]
Producthypothetical protein
NoteTssB
UniProt IDF2ISB8
KEGG IDvcl:VCLMA_B0095
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-58, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|384422627|ref|YP_005631986.1| hypothetical protein VCLMA_B0095 [Vibrio cholerae LMA3984-4]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKNNFEAVMRESE
LKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERL
QSLLNSEESREKLLAELNLLSGQEEPQA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|384422536|ref|NC_017269.1|:114221-114727 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGTCTAAAGAAGGAAGTGTAGCTCCCAAAGAGCGGATTAATATCAAGTATATTCCGGCGACGGGGGATG
CACAGGCTGAGGTTGAGCTACCACTCAAAACCCTGGTTGTAGGTGATTTCAAAGGGCATGCGGAGCAAAC
CCCATTGGAAGAGCGTGCAACAGTCACGGTAGATAAGAACAACTTTGAAGCCGTAATGCGCGAGAGCGAG
CTGAAAATCACCGCCACGGTGAAAAACAAGCTGACTGATGATGAGAATGCCGAGCTTCCTGTTGAACTCA
ATTTCAAATCCTTAGCCGACTTCGCTCCTGATGCGGTGGCATCACAAGTTCCAGAACTGAAAAAATTGAT
TGAGTTGCGTGAAGCGTTAGTTGCCCTTAAAGGGCCGCTAGGCAACATTCCCGCATTTCGTGAGCGTTTA
CAGTCATTACTCAACTCAGAAGAGTCGAGAGAAAAACTGTTGGCAGAACTGAATCTGCTCAGTGGTCAAG
AAGAGCCACAAGCGTAA