SecReT6
Protein ID: 384422628
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0096
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]114771..116246 [+]
Producthypothetical protein
NoteTssC
UniProt IDF2ISB9
KEGG IDvcl:VCLMA_B0096
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-191, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|384422628|ref|YP_005631987.1| hypothetical protein VCLMA_B0096 [Vibrio cholerae LMA3984-4]
MSTTEKVLERPQLAQGSLLDEIMAQTRIAPSEEGYDIAKKGVAAFIENLMGSQHSAEPVNKSLVDQMLVE
LDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVTKDELLEDFEFAPETAQSGLYK
HVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIKD
LKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPIENPVKSFNYAENVSASHEHYLWGNTAFAF
ATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLITDRKEFELAEEGFIALTMRK
GSDNAAFFSANSIQKPKVFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLER
ELNSWIKQYVADQENPPADVRSRRPLRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGANFELSLVGRLDQ
A
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|384422536|ref|NC_017269.1|:114771-116246 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGTCTACGACTGAAAAGGTATTGGAAAGGCCACAGCTTGCTCAAGGCAGCCTTCTTGATGAAATTATGG
CGCAAACCCGTATCGCACCAAGCGAAGAGGGTTACGACATCGCGAAAAAAGGTGTTGCAGCGTTTATCGA
AAATCTTATGGGTTCACAACACTCTGCTGAGCCTGTCAACAAATCTCTGGTTGACCAAATGTTGGTTGAA
CTGGATAAAAAAATCAGTGCACAGATGGATGAAATCCTGCACAACTCACAATTCCAAGCGATGGAATCGG
CGTGGCGCGGTTTGAAGCTGTTCGTGGATCGCACTGATTTTCGTGAAAATAACAAAGTCGAAATCCTTCA
CGTAACCAAAGATGAACTGCTGGAAGATTTCGAGTTTGCTCCAGAAACGGCTCAGTCCGGTCTTTACAAG
CACGTTTATTCTGCCGGTTATGGTCAATTTGGTGGCGAACCTGTTGGCGCGATCATTGGTAACTATGCGT
TTACCCCTTCAACGCCAGATATGAAGCTGCTGCAATACATGGGCGCACTGGGTGCCATGGCGCATGCTCC
TTTCATTTCAAGCGTAGGTCCTGAATTCTTTGGTATCGACTCCTTCGAAGAACTGCCTAACATTAAAGAT
CTCAAGTCGACATTTGAAAGCCCGAAATACACCAAATGGCGTTCACTGCGTGAATCGGAAGATGCGCGCT
ATCTTGGTTTGACTGCGCCTCGTTTCCTGCTGCGTGTTCCTTACGATCCAATCGAAAATCCAGTGAAGTC
GTTCAATTATGCGGAAAACGTCAGTGCTTCGCACGAGCACTACCTGTGGGGTAACACGGCATTTGCCTTC
GCAACTCGTTTGACGGATAGCTTTGCTAAATATCGCTGGTGTCCAAACATTATCGGTCCACAAAGTGGTG
GTGCAGTTGAAGATCTGCCGGTGCATGTCTTTGAATCTATGGGTGCATTGCAAAGCAAGATCCCAACCGA
AGTCCTGATCACGGACCGTAAAGAGTTTGAACTGGCGGAAGAAGGTTTTATTGCTCTTACTATGCGTAAA
GGCAGTGATAACGCGGCGTTCTTCTCTGCAAACTCCATTCAAAAACCTAAGGTTTTCCCAAATACCAAAG
AAGGCAAAGAAGCGGAAACCAACTACAAGTTGGGTACCCAGTTGCCGTACATGATGATCATCAACCGTTT
GGCGCACTATGTGAAAGTTCTGCAACGTGAGCAGATCGGTGCTTGGAAAGAGCGTCAAGATCTTGAGCGT
GAACTGAACTCATGGATCAAACAATACGTTGCTGATCAAGAGAACCCACCTGCAGACGTACGTAGCCGTC
GTCCACTTCGTGCTGCGCGCATTGAAGTGATGGATGTGGAAGGCAATCCAGGTTGGTATCAGGTGTCGCT
CTCGGTTCGTCCTCACTTTAAGTACATGGGTGCGAACTTTGAGTTGTCATTAGTTGGACGTCTTGATCAA
GCCTGA