SecReT6
Protein ID: 384422629
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0097
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]116249..116686 [+]
Producthypothetical protein
NoteTssE
UniProt IDF2ISC0
KEGG IDvcl:VCLMA_B0097
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-20, Aligned region: 37..127
Protein Sequence: 145 a.a.     [Download]
>gi|384422629|ref|YP_005631988.1| hypothetical protein VCLMA_B0097 [Vibrio cholerae LMA3984-4]
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDA
TLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITATINSEALHEKVQFSLLLDQSR
KYRVF
 
Nucleotide Sequence: 438 bp     [Download]
>gi|384422536|ref|NC_017269.1|:116249-116686 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGACGTACATCGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTTTTCGAACGTTTGGAAGCCAACGCCA
AACCTATGTCGCTGACCCGTGGGCCAGACGCGTGGGATGTACTCGAATCGATCAAACGGAATGTCTCTAA
CATTCTGAACACTCGAATTGGTGGAGCGCAAAGTGCCCCTCATCTCGGGTTGGTGGATTTTAATGATGCA
ACGCTGGAAACCTTAGATCTCTCCGTGCGAATTAAATTGGCGATTCAACAGTGCCTTGAGCGCTATGAGC
CGCGTTTAACTCGCGTTCTGGTGAGAGCGGATCAAGATAGCTTTAACCCGCTGACTTTAAGGTTCCACAT
TACCGCGACCATCAATAGCGAAGCGTTACACGAAAAAGTCCAGTTCAGTCTGTTATTGGATCAAAGCAGA
AAATATCGAGTGTTTTAA