SecReT6
Protein ID: 384422631
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0099
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]118647..119441 [+]
Productprotein ImpH/VasB
NoteTssG
UniProt IDF2ISC2
KEGG IDvcl:VCLMA_B0099
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-80, Aligned region: 4..251
Protein Sequence: 264 a.a.     [Download]
>gi|384422631|ref|YP_005631990.1| protein ImpH/VasB [Vibrio cholerae LMA3984-4]
MALEARDDERWVMLTNFFGLSGAQSPLPGFILEQLVTEEPGGYKQPFLDFFNNRLINLVYRVWRKYRYYV
RFQPGAQDVFSAQLFALVGLGDPDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLPDVSIRQ
WVRRRVSIDRSQQLALGKQNARLGMDTVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLCKLVE
FILREQMAYDLELAMDEREAPLFCLDTRQNIALGWTSFLGQDAANKHVLIQVRQ
 
Nucleotide Sequence: 795 bp     [Download]
>gi|384422536|ref|NC_017269.1|:118647-119441 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGGCGCTTGAAGCGCGTGACGATGAGCGTTGGGTTATGTTGACCAACTTTTTTGGCCTTTCTGGTGCAC
AGTCACCTCTGCCGGGGTTCATCCTTGAGCAATTGGTGACGGAAGAGCCTGGGGGGTATAAGCAGCCGTT
TCTCGATTTTTTCAATAACCGATTGATTAATTTGGTTTATCGCGTTTGGCGTAAATACCGTTACTACGTA
CGTTTTCAGCCCGGTGCGCAGGATGTGTTCTCTGCACAGCTGTTTGCGCTGGTGGGGTTGGGCGATCCTG
ACCTTCGCGGTGAAACGCCGATCAACTGGTGCAAAATGCTGGCTTACGCGGGCACGCTGGCCGGACGTAG
CCGTTCGCCACAAGTCGTGGCCGGCATTATTGCTCATTGTTTTGATTTACCGGATGTCTCCATTCGCCAG
TGGGTCAGACGTCGGGTATCGATTGATCGGAGTCAGCAACTGGCGCTGGGCAAGCAGAATGCGCGGTTGG
GGATGGACACGGTGATTGGCGAGTCCGTTATTGATTGCAGTGGAAAATTTATTATCTGTATCAAACGGTT
ATCTCGCAGTCGTTTTGCTGATTTTTTGCCCTCCGGTAAAGAGTATCAGCCACTTTGCAAGCTGGTGGAG
TTTATTTTGCGCGAACAGATGGCGTATGACCTCGAGCTGGCGATGGATGAACGAGAAGCGCCGCTGTTTT
GTCTGGATACTAGACAGAATATCGCCCTCGGCTGGACTTCGTTTCTTGGCCAAGATGCAGCCAATAAACA
TGTGTTAATTCAAGTAAGGCAATAA