SecReT6
Protein ID: 384422634
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0102
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]121417..122751 [+]
Producthypothetical protein
NoteTssK
UniProt IDF2ISC5
KEGG IDvcl:VCLMA_B0102
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-161, Aligned region: 19..443
GMP_synt_C [PF00958], Evalue: 0.00014, Aligned region: 63..139
GMP_synt_C [PF00958], Evalue: 0.00014, Aligned region: 302..374
Protein Sequence: 444 a.a.     [Download]
>gi|384422634|ref|YP_005631993.1| hypothetical protein VCLMA_B0102 [Vibrio cholerae LMA3984-4]
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRIAIERAVGVMP
DGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERGTGRYVSRRLEVRDVHSVQGD
TTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSVVLDPDFIPCHLNVVGISALHRFINEMSGLM
RERAKNIAQRISSPAQGGVADVSDFMLLQALNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDES
RLPPSLPSYNHDSPSHSFQPLIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVK
ARMPLDELRRLFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTH
SSGFAFHVAAAFDDLELQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|384422536|ref|NC_017269.1|:121417-122751 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGTTTGCGCGTAACCGAGTGATCTGGAATGAAGGGCTATTTATTAAGCCGCAACATTTCCAGCAACAGC
AGAGATATACGGAGTACTGCCTAGACGAGCGCCTGAGCACCGTGAGCCGTTACTTGTATGGGATTTCCGA
GTTGTCGCTCAACCCAGAATACCTCTCGTTTGGCCGTATTGCGATTGAGCGTGCGGTCGGCGTGATGCCC
GATGGCACCACCTTTCGTATTCCTCAAGAAGATCATCTTCCCGATGCGCTCGAAGTGACCGATGCGTCAC
TGGCAAACCAGATTGTCTACTTAGCCGTACCGCTACGTAGTGAGTCGCTGATGGAGATTAACTGGCCAGA
AGAGCGTGGTACGGGGCGCTATGTCAGCCGTCGTCTCGAAGTGCGTGATGTCCACAGCGTGCAGGGTGAT
ACCACGACGATTGATGTTTCCCCTGTGCGTTTGCAACTCATGCTTGAGCGAGAGGATCGCAGTGCGTATG
CCTCAATTGCTATTGGCCGTATTTTAGAAAAACGTCCTGATGGCAGTGTGGTGCTCGATCCGGATTTCAT
CCCTTGTCACTTGAATGTGGTTGGCATCTCTGCGCTGCACCGCTTTATTAATGAGATGTCAGGCCTGATG
CGTGAGCGAGCGAAAAATATTGCTCAGCGGATCAGCTCTCCAGCACAAGGTGGGGTTGCTGATGTTTCGG
ACTTTATGCTGCTGCAAGCTTTAAACCGTCTGCAACCACAAATGAAGCATTTGGCAGAGCTGCGCAGCTT
ACACCCAGAGCGTCTGTTTGAATGTCTCTCGTGTGTGTGTGGTGAGCTGGCTACCTTTACTGACGAAAGT
CGTCTGCCGCCCAGTTTGCCAAGCTATAACCATGATTCACCCAGCCACTCTTTCCAGCCGCTGATCCGCA
GCTTGCGTCAGAGCTTGAGCGTGGTGCTAGAGCCGCGCGCCGTCTCTATCCAACTGGATAAACGTAAGTA
CGGTTTGATGGTTGCGCCAATCCATGATCCGCAACTGATGGAGAGTGCAGAGTTTATCATCGCGGTTAAA
GCTCGCATGCCGTTGGATGAGCTACGCCGTCTGTTTACTCAGCAAACCAAAGTGGCATCGGTTGAGAAAA
TTCGTGAACTCATCTCACTGCAACTGCCGGGTATTCCATTGACGCCATTACCGGTCGCACCGCGCCAATT
GCCTTACCACGCTGGCTACACCTACTACCAACTGGATAAAACCAGCGCTGCATGGGCGATGTTGACTCAT
TCCAGCGGTTTTGCGTTCCACGTTGCTGCAGCTTTTGACGATCTTGAGCTGCAATTCTGGGCTATCAGGA
GCTAA