SecReT6
Protein ID: 384422635
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0103
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]122754..123527 [+]
ProductOuter membrane protein ImpK/VasF, OmpA/MotB domain protein
NoteTssL
UniProt IDF2ISC6
KEGG IDvcl:VCLMA_B0103
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-69, Aligned region: 37..242
Protein Sequence: 257 a.a.     [Download]
>gi|384422635|ref|YP_005631994.1| Outer membrane protein ImpK/VasF, OmpA/MotB domain protein [Vibrio cholerae LMA3984-4]
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTI
EEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILS
RLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRA
KYTLSRQMPVWSVFAGFIVLWIGLFLGYSYVLHSKSSDVLNQLNQIL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|384422536|ref|NC_017269.1|:122754-123527 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGTCACAGAGTAAAAAAGAGACGCCATTAGCCAGTTTGTTGTTCGACGATGTGGAAAAAATTAACCACG
ACCAAGACTACTGGTTCCAATTGCGTGGGGACAATCCGAATGTGCTGATTGATGCCGCGACACCCTTGTT
TGGGCTTTCTCTGCGGGTTCGCACCCTCACTGAATGCGACAACATTGAACAGATCTACCGTCAGACGATT
GAAGAGATCAAAGCGATTGAAATTGAGTTGACGGAGCAAGGTTACGAACACGCCATTTTGATGGCCTATC
GTTACATCTTGTGCGCCTTTTTGGATGAATCCGTGATGGGAACCGAGTGGGGCGCGTCCAGTTTATGGGC
CGAGCACTCCATGCTGTCACGTTTCCATAATGAAACGTGGGGTGGCGAGAAAGTGTTTACGATTTTGAGC
CGTCTTGAGGGTGAGCCACACCGTTACCAAGCGCTATTGGCCTTTATTTATCACTGCCTGATTTTGGGCT
TTGAAGGCAAATACCGTGTGATGGAAGGGGGACAAGCTGAGCGCGAAAAAGTGATCAGCCGCCTGCATCA
ACTGCTGAGCAGCTTGGAAGAGAGCGAGCCACAAGACTTAACCCGTCCGACCGATCATGTGGTGCGTGCG
AAATATACCCTAAGCAGACAGATGCCTGTGTGGTCTGTGTTTGCTGGCTTTATCGTGCTTTGGATAGGTC
TATTTCTCGGCTACAGCTATGTGCTGCATAGCAAATCCAGCGATGTGCTCAATCAACTCAATCAAATACT
TTAA