SecReT6
Protein ID: 384422636
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0104
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]123553..126162 [+]
ProductClpB protein
NoteTssH
UniProt IDF2ISC7
KEGG IDvcl:VCLMA_B0104
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.40E-38, Aligned region: 221..241
AAA_2 [PF07724], Evalue: 3.40E-38, Aligned region: 607..768
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 221..352
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 613..730
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 777..821
ClpB_D2-small [PF10431], Evalue: 5.20E-14, Aligned region: 774..848
AAA_5 [PF07728], Evalue: 6.30E-13, Aligned region: 221..244
AAA_5 [PF07728], Evalue: 6.30E-13, Aligned region: 612..730
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 80..113
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 200..236
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 258..299
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 583..653
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 220..313
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 516..547
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 609..636
AAA_25 [PF13481], Evalue: 9.70E-08, Aligned region: 221..262
AAA_25 [PF13481], Evalue: 9.70E-08, Aligned region: 607..645
Clp_N [PF02861], Evalue: 2.50E-06, Aligned region: 24..71
AAA_14 [PF13173], Evalue: 6.20E-06, Aligned region: 221..322
AAA_14 [PF13173], Evalue: 6.20E-06, Aligned region: 490..535
AAA_14 [PF13173], Evalue: 6.20E-06, Aligned region: 611..694
Arch_ATPase [PF01637], Evalue: 8.20E-06, Aligned region: 130..163
Arch_ATPase [PF01637], Evalue: 8.20E-06, Aligned region: 201..241
Arch_ATPase [PF01637], Evalue: 8.20E-06, Aligned region: 612..652
NACHT [PF05729], Evalue: 7.00E-05, Aligned region: 221..250
NACHT [PF05729], Evalue: 7.00E-05, Aligned region: 370..447
NACHT [PF05729], Evalue: 7.00E-05, Aligned region: 613..641
DUF258 [PF03193], Evalue: 9.60E-05, Aligned region: 193..238
DUF258 [PF03193], Evalue: 9.60E-05, Aligned region: 612..653
AAA_29 [PF13555], Evalue: 0.00028, Aligned region: 213..238
AAA_29 [PF13555], Evalue: 0.00028, Aligned region: 608..623
AAA_19 [PF13245], Evalue: 0.0003, Aligned region: 218..242
AAA_19 [PF13245], Evalue: 0.0003, Aligned region: 609..634
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 215..342
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 611..630
AAA_17 [PF13207], Evalue: 0.00055, Aligned region: 221..260
AAA_17 [PF13207], Evalue: 0.00055, Aligned region: 613..647
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 221..288
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 312..383
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 467..510
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 613..657
Sigma54_activat [PF00158], Evalue: 0.00098, Aligned region: 219..237
Sigma54_activat [PF00158], Evalue: 0.00098, Aligned region: 610..710
DUF815 [PF05673], Evalue: 0.0014, Aligned region: 217..296
DUF815 [PF05673], Evalue: 0.0014, Aligned region: 564..646
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 222..242
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 613..635
MobB [PF03205], Evalue: 0.0051, Aligned region: 221..242
MobB [PF03205], Evalue: 0.0051, Aligned region: 612..634
SRP54 [PF00448], Evalue: 0.0072, Aligned region: 221..265
SRP54 [PF00448], Evalue: 0.0072, Aligned region: 612..633
Zeta_toxin [PF06414], Evalue: 0.0097, Aligned region: 221..238
Zeta_toxin [PF06414], Evalue: 0.0097, Aligned region: 595..652
Protein Sequence: 869 a.a.     [Download]
>gi|384422636|ref|YP_005631995.1| ClpB protein [Vibrio cholerae LMA3984-4]
MIRIELPTLIAKLNAQSKLALEQAASLCIERQHPEVTLEHYLDVLLDNPLSDVRLVLKQAGLEVDQVKQA
IALTYSREQVLDTYPAFSPLLVELLQEAWLLSSTELEQAELRSGAIFLAALTRSDRYLSFKLISLFEGIN
RENLKKHFAMILSDSAETAVAKTDKNAANPLQAAAETPLGRFCTNVTEQARNGELDPVLSRENELNLMVD
ILCRRRKNNPIVVGEAGVGKSAMIEGLALRVVAGKVPTQLQNVELYSLDLGRLQAGASVKGEFEKRLKGV
IDAIKQSPKPIILFIDEAHTLIGSGNQEGGSDAANLLKPALARGELSTVAATTWKEYKKYFEKDPALTRR
FQLVKLDEPTIDQAVDILRGLNSVYEKAHNVLITDDALKAAAELSARYISGRQLPDKAIDVLDTACARIA
INMTTPPKRLALLETLCHQRQLEIDMLERAQFLGQEVDSERLDVLRNQELADEAEKAALTQSWQQQKSLV
ESIIALRAELMELSQAQEQDPDHLLVVRTALQEQYQALDAIDHAERLMHPQVDADQIAEVIADWTGVPVD
QMNTDELHKITHLTSILGQAIKGQETAIERIHRHLLTARADLRRPGRPKGAFLLVGPSGVGKTETVVQLA
EQLYGGKQFLTTINMSEYQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRKMPYSVVLLDEVEKAHPEVLNI
FYQGFDKGEIADGEGRVIDCQNIVFFLTSNLGYQTIVDYADEPAKLDEVLYPELAAFFKPALLARMEVIP
YLPLGKEVLAQIVRGKLARLEKLFKTRYNAEVVIEESLIDEILSRATRSENGARMLEAIIEGQLLPPVSL
ALLNKLAERAPVERIRLAAEAGEFIGEVA
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|384422536|ref|NC_017269.1|:123553-126162 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
GTGATCCGTATTGAATTACCCACTCTTATTGCAAAACTGAATGCACAAAGCAAATTGGCTCTGGAGCAAG
CGGCTTCTCTTTGTATTGAGCGCCAACACCCTGAAGTCACACTAGAACATTATCTGGATGTGTTACTGGA
TAATCCCCTCTCTGATGTGCGTCTCGTACTCAAGCAAGCGGGGCTGGAAGTCGATCAGGTGAAACAGGCC
ATCGCATTAACCTATAGCCGTGAACAGGTCTTGGATACCTATCCAGCGTTTTCGCCACTGCTGGTCGAGT
TACTGCAAGAAGCTTGGCTGCTTTCCAGTACCGAGTTAGAGCAGGCTGAGCTGCGTTCAGGGGCGATTTT
CTTAGCCGCGCTGACCCGTTCGGACCGTTATCTGTCATTCAAATTGATCAGTTTGTTTGAAGGCATCAAC
CGCGAAAACCTCAAAAAACACTTTGCGATGATCTTAAGTGATTCTGCAGAAACCGCAGTGGCTAAAACAG
ACAAAAATGCGGCCAATCCACTACAAGCCGCCGCAGAAACACCACTCGGACGCTTTTGCACGAATGTGAC
TGAGCAAGCCCGTAACGGTGAGCTTGATCCTGTCCTGAGCCGTGAAAATGAACTCAACTTGATGGTGGAT
ATTCTGTGCCGTCGCCGCAAAAACAACCCGATTGTGGTGGGAGAAGCAGGTGTTGGTAAAAGTGCCATGA
TTGAAGGTTTGGCGCTGCGTGTAGTGGCTGGCAAAGTGCCCACCCAACTGCAAAATGTAGAACTCTATTC
GTTGGATCTTGGTCGCTTGCAAGCGGGTGCATCGGTGAAAGGCGAGTTTGAAAAGCGCCTAAAAGGGGTG
ATTGATGCGATTAAGCAATCGCCTAAACCGATCATTTTATTCATCGATGAAGCGCACACCTTAATTGGTT
CTGGTAACCAAGAAGGGGGCAGTGATGCGGCAAACTTGCTCAAGCCTGCGCTGGCGCGTGGTGAGTTAAG
CACAGTGGCGGCGACGACGTGGAAAGAGTACAAAAAGTATTTTGAAAAAGATCCCGCGCTGACGCGCCGT
TTCCAACTGGTCAAACTCGATGAACCAACGATCGATCAAGCCGTCGATATTCTGCGCGGTCTTAACAGTG
TCTATGAAAAGGCACACAACGTACTCATCACTGATGATGCACTAAAAGCTGCCGCTGAACTGTCAGCGCG
TTACATCTCAGGTCGTCAACTGCCCGATAAAGCGATTGATGTGCTGGATACCGCTTGTGCGCGGATTGCG
ATCAATATGACCACGCCACCTAAGCGTTTAGCGCTACTTGAAACCTTGTGCCATCAGCGTCAACTCGAAA
TTGACATGCTAGAGCGGGCGCAATTCCTTGGCCAAGAGGTCGATAGCGAGCGCCTTGATGTTCTGCGTAA
TCAAGAGTTGGCCGATGAAGCGGAAAAAGCCGCGTTGACACAGAGTTGGCAGCAGCAAAAAAGCTTGGTG
GAGTCGATCATCGCACTGCGTGCTGAGCTGATGGAGTTAAGCCAAGCGCAAGAGCAAGATCCCGACCATT
TATTGGTGGTGCGTACGGCGCTGCAAGAGCAGTATCAAGCACTCGATGCGATTGATCATGCTGAGCGTTT
GATGCACCCGCAAGTCGATGCGGATCAGATTGCTGAAGTGATCGCCGATTGGACGGGGGTGCCTGTTGAT
CAGATGAACACCGATGAGCTGCATAAAATCACCCATTTGACCTCGATTTTAGGTCAAGCGATCAAAGGCC
AAGAAACGGCCATCGAACGTATCCATCGTCACTTACTGACAGCGCGCGCCGATCTGCGTCGTCCGGGACG
TCCGAAAGGGGCATTCCTGCTGGTGGGGCCAAGCGGTGTAGGTAAAACCGAAACGGTAGTGCAACTGGCA
GAGCAGCTTTACGGTGGTAAACAGTTCCTCACCACCATCAACATGTCGGAATACCAAGAGAAACACACCG
TTTCCCGCCTGATTGGTTCACCTCCGGGTTATGTTGGCTACGGTGAAGGCGGTGTGCTGACGGAGGCAAT
CCGTAAGATGCCTTATTCGGTGGTTCTGCTTGATGAAGTCGAAAAAGCCCATCCAGAAGTTTTAAATATC
TTCTACCAAGGCTTTGATAAAGGCGAAATCGCCGATGGTGAAGGTCGTGTCATCGACTGCCAAAACATCG
TGTTCTTCCTGACATCGAACTTAGGCTACCAAACCATAGTCGATTATGCCGATGAGCCCGCCAAGCTTGA
TGAAGTGCTTTATCCTGAATTGGCCGCTTTCTTTAAACCTGCTCTGCTGGCGCGTATGGAAGTGATCCCT
TACCTACCACTGGGTAAAGAAGTGTTGGCACAGATTGTTCGCGGCAAGCTGGCTCGTCTCGAGAAACTGT
TCAAGACACGTTACAACGCAGAAGTGGTGATTGAAGAGAGCTTAATTGACGAAATCTTAAGCCGTGCGAC
ACGCAGCGAAAACGGTGCGCGTATGCTGGAGGCGATCATTGAAGGGCAATTGCTGCCGCCCGTTTCATTG
GCGCTGCTGAATAAACTCGCCGAGAGAGCGCCCGTTGAGCGCATTCGTTTAGCGGCAGAAGCGGGTGAAT
TTATCGGAGAGGTAGCGTAA