SecReT6
Protein ID: 384422639
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0107
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]128420..129829 [+]
Producthypothetical protein
NoteTssA
UniProt IDF2ISD0
KEGG IDvcl:VCLMA_B0107
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-16, Aligned region: 49..109
Protein Sequence: 469 a.a.     [Download]
>gi|384422639|ref|YP_005631998.1| hypothetical protein VCLMA_B0107 [Vibrio cholerae LMA3984-4]
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKLLGEQSKDIKL
LVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGARGNLPRRKFVSQMAQRFTTVIEKFDFHHL
DEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEIKRAEQRQQVTAQSSAEREIPSAATPSPAAS
MVVDHSSDKAAKQTLLKVADFLAEQEFGIALSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQ
DQLRHPDLALWRKVEQSLTMAPYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGE
PFVSDSVKEWLASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTALSVPEWEPSLVEQIQRYTTSE
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|384422536|ref|NC_017269.1|:128420-129829 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGGAAATGACTGAATACCGTCAGTGTGTGGCCAAACCGATCAGCAGTAGCAATCCTGTCGGAGAGCGGC
TAGTCGATCACCCACTGTTTGATTTTATTGAAGATCAGATGATGAAAGTGGGCTCTCTCTCTCACGCTTC
AGTGCAGTGGGATGAAGTGGAGCACAGCACTCTCAAACTGCTTGGTGAACAGAGTAAAGACATCAAGCTT
TTGGTTTACCTGCTGCAGTGTCTGCATAACCAAGTTACCCCGACGCGCCTTATTACCTCGTTTGCGGTGA
TGAGTGAGTTCCTCAATCAATATTGGAACGACAGTTATCCAGCGCCGGGCGCACGTGGCAATCTGCCGCG
ACGTAAATTCGTCAGCCAGATGGCGCAACGTTTTACCACGGTGATCGAAAAATTCGATTTTCATCATCTG
GATGAAGCGGATCGCCAAGCGCTACAAGCGGCGGTTGAAGAGTGGCAACAAGCCGTTGAGAAACAAGGGC
TCTCTTCTGAGTTGGTGGAGTCTGTGGTGGTGCGAATTACCGCGGAGATCAAACGCGCAGAGCAGCGCCA
GCAAGTGACGGCGCAAAGCAGCGCGGAGCGTGAAATACCAAGTGCTGCAACGCCTTCTCCTGCGGCGAGC
ATGGTGGTGGATCATTCGAGTGACAAAGCAGCGAAACAAACCCTACTCAAAGTGGCAGATTTTCTTGCCG
AACAAGAGTTTGGTATCGCGCTGTCGATTCGTCTGCGCCGCTTTGCGGTGTGGGGCAGCATTACCTCATT
GCCCGATCATAAACCCGATGGTGAAACACTGCTGCGTGGAATGCAGGCGGATCGCGTCAAGGATTACCAA
GATCAACTCCGTCACCCCGATTTAGCCTTGTGGCGCAAAGTCGAACAGAGCTTAACCATGGCTCCTTATT
GGTTTGAAGGACAGTGGATGAGTTACACCATTGCCCAGCAACTCGGCAAAAGTGATTGGTGTCAGGCGAT
TGCCGAAGAAACACAACAGTTTTTACGTCGTTTGCCTTCGCTGCTTGAGCTCAAATTCAAAGGCGGAGAG
CCGTTTGTCAGCGATTCGGTCAAAGAGTGGCTGGCGAGCGTAGGTCAGAGCCAAGGTGCTGCGGGGCAAT
CGGTCGGCGGAGATTGGCAAGAGAAGCGTAAAGAGGCGTTTCAACTGGCCAAAGAAGGCGGAATCGCGGT
GGCTCTTTCCATGCTCAATGATGGCTTGGTCAGTGCGGTGGAGCCGCGTGACAAATTTTACTGGCGATTG
CTATCGGCGGATCTGCTGCGGGCAAATCATCTCGATGCGATGGCTGGTGAACAGTATCAAACTCTGCTCA
ATCAGGTAACGGCGCTGTCTGTTCCTGAGTGGGAGCCGAGTTTAGTGGAACAAATTCAAAGATATACAAC
GTCAGAGTAA