SecReT6
Protein ID: 384422641
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0109
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]133441..134706 [+]
ProductType VI secretion-like protein VasL
NoteTssA
UniProt IDF2ISD2
KEGG IDvcl:VCLMA_B0109
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.20E-11, Aligned region: 46..100
Cytochrom_B562 [PF07361], Evalue: 0.0026, Aligned region: 119..135
Cytochrom_B562 [PF07361], Evalue: 0.0026, Aligned region: 171..184
Cytochrom_B562 [PF07361], Evalue: 0.0026, Aligned region: 324..396
Protein Sequence: 421 a.a.     [Download]
>gi|384422641|ref|YP_005632000.1| Type VI secretion-like protein VasL [Vibrio cholerae LMA3984-4]
MSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLACNQGMDFLICGY
YAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNARVVQELKALKPTYESLRDLYRA
ERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQYHSLLKKQEKAQPPKLKFWQRGYALFTLGVL
GVALGVVGGYWGWPWFYTTPYAAPQRITTLNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTIS
FSEPKRHAITQLNLLRTLYPENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANIALLAKRGKWA
ELEKQTKSLEEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLGKLPSLSSVSAMRLCCSD
G
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|384422536|ref|NC_017269.1|:133441-134706 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGTCCAATGTGATTTTTATTGATAACGTTTGCTACCGATTAACCAATGATTCTGAGGAGATTCGCGGAT
TAGAGCCCTATGCGAAGGTTCGTGAGGAGATAAACCGCCGCTTTAATCCGATTGCCGGGGGTACGGATTG
GGCAGTGGTAAAAGAGTACTGTGAACAACTGGCCTGTAACCAAGGAATGGATTTTCTGATCTGCGGTTAC
TATGCGGTAGCCTGCCTGAAAACTCAGGGGCTGGCGGGGTATGCCACCGGTATGGAGCTGATGAGTGCAA
GCCTTGCCAACCAAGGTGAGTGTGATGTGAAAAGCGCCAAAGTGCGCAAAGAGATCCTCGATTGGGTCAA
TGCACGTGTGGTGCAGGAACTGAAAGCACTTAAGCCAACTTATGAGTCGCTGCGAGATCTGTATCGGGCT
GAGCGCCATTGCGAGCGGTTACATCAGCTGTTTGAACAACAACAAACTGAATACAAAGTAGACTTTGAAG
GGGTCGGGTTTGCTCTGTTTGAACACATAGACAGAATTGAAACCCAATACCACAGCTTATTGAAAAAGCA
GGAGAAGGCTCAGCCACCTAAGCTTAAGTTTTGGCAGCGCGGTTACGCGTTGTTCACTCTAGGTGTACTT
GGGGTTGCACTGGGAGTGGTGGGGGGCTACTGGGGGTGGCCTTGGTTTTATACCACGCCTTATGCCGCGC
CACAGCGCATCACCACGTTGAATGAGGCCTCTCAAACTCAAGCACTGCTCAACGACTCTTCTACAAGTGA
GCGTGCGCGTTGGCAACATGATCTGATCCCGCTGTATCGCGATACTTTGCAGCAGAATTTAACCATCTCG
TTTAGTGAACCTAAGCGACATGCCATCACTCAGCTGAATCTATTGCGCACTCTTTATCCTGAAAACGAGC
AAGTGAATGCACTGAGTCAAGAGTTTGCCCTTCAGCAGCAACAAGCGTTGGAGCAAACCGCGCTGTTCGT
GGCCAAGTTCAGCGAAATTCGCACCAAAATGGCCAATATCGCGTTACTGGCTAAGCGAGGGAAATGGGCT
GAGTTAGAAAAGCAGACCAAATCATTAGAAGAGTTCGCGGTCAGCCTATCACCGATTTATGGTCGAGTTG
ACTATGTGCAAGGCCTCCTTGAACAGGGCGATGTCACAAATGCCCAGAAAGAGTTTGCGATCCTCAAACA
AAGGCTAGATAGCCTTGGAAAATTGCCGAGCTTGAGCAGCGTATCGGCGATGCGGCTTTGTTGCAGTGAT
GGCTGA