SecReT6
Protein ID: 384527697
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23336
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]121369..121863 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDH8NZY5
KEGG IDraa:Q7S_23336
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-55, Aligned region: 6..158
Protein Sequence: 164 a.a.     [Download]
>gi|384527697|ref|YP_005418929.1| type VI secretion protein [Rahnella aquatilis HX2]
MSNSFQNEIPKARVNIKLDLHTGGAQKKVELPLKLMVMGDYSNGKENRPLSEREKVNINKNNFNSVLAEF
SPSLNLTVENTLTGDRSEENISLNFNEMKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNVTFRKEL
EAILKDPALSNELRTELNALAPKA
 
Nucleotide Sequence: 495 bp     [Download]
>gi|384527587|ref|NC_017060.1|:121369-121863 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGTCTAATAGCTTCCAGAATGAAATTCCGAAAGCGCGCGTTAACATAAAACTTGATCTACACACTGGCG
GCGCACAGAAGAAAGTCGAATTACCGTTAAAATTGATGGTAATGGGTGATTACAGTAATGGAAAAGAGAA
CCGTCCGTTATCTGAACGCGAAAAAGTTAACATTAATAAGAATAACTTTAACAGCGTACTGGCTGAATTC
AGCCCTTCACTGAACCTGACCGTGGAAAATACGCTAACAGGTGATCGCAGCGAAGAAAATATCTCTCTAA
ATTTCAATGAAATGAAAGATTTTGAGCCAGAACAGGTTGCCCGTCAGATCCCCCAACTGCGCGCGATGCT
GGCAATGCGTAACTTATTACGTGACCTCAAATCCAATCTGCTCGACAACGTCACCTTCCGTAAAGAGCTC
GAAGCCATTCTAAAAGATCCTGCGCTGAGCAATGAACTGCGCACTGAACTTAATGCCCTGGCGCCAAAGG
CGTAA