SecReT6
Protein ID: 384527698
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23341
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]121895..123442 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDH8NZY6
KEGG IDraa:Q7S_23341
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.80E-177, Aligned region: 90..511
Protein Sequence: 515 a.a.     [Download]
>gi|384527698|ref|YP_005418930.1| type VI secretion protein EvpB [Rahnella aquatilis HX2]
MLMSVNTENSSSSQTTVLDRPDAGTVYASLFDKINLTPVSSLGDLNDFQDTSALADVTADQRVTAAVQVF
LERLKLSGQTVERLDKTLLDHHIAELDSQISRQLDVVMHHPEFQRIESGWRGLKFLVDRTDFRQNVKIEL
LDVSKDDLRQDFEDCPEIIQSGLYRHTYIQEYDTPGGEPIGSVISNYEFDASAQDVALLRNISKVSAAAH
MPFVGAVGPKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDSDDSRYIGLTMPRVLGRLPYGPDTVPV
RSFNYVEEVKGPDHEKYLWTNAAFAFAANMVKSFIKNGWCVQIRGPQAGGAVTDLPIHLYDLGTGNQVKI
PSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTANATANSRINARLPYIFLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWIRTLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLY
AVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1548 bp     [Download]
>gi|384527587|ref|NC_017060.1|:121895-123442 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGCTCATGTCAGTCAACACTGAAAACTCTTCTTCCAGCCAGACAACGGTTCTGGATCGCCCTGACGCCG
GTACGGTATACGCTTCCCTGTTTGATAAAATCAACCTGACGCCTGTGTCCTCACTGGGTGATCTGAACGA
TTTTCAGGATACGTCTGCGCTGGCCGATGTCACCGCTGATCAGCGTGTCACTGCCGCTGTACAGGTCTTC
CTTGAGCGCCTGAAGCTGTCCGGTCAGACGGTTGAACGTCTGGACAAAACCCTGCTCGATCATCATATCG
CCGAACTCGACAGCCAGATCAGCCGTCAGTTGGATGTGGTCATGCATCACCCGGAATTTCAGCGTATTGA
ATCCGGCTGGCGTGGTCTGAAGTTCCTGGTTGATCGTACTGATTTCCGCCAGAACGTAAAAATTGAACTG
CTGGATGTGTCTAAAGACGACCTCCGTCAGGACTTCGAAGATTGTCCTGAGATCATCCAGAGCGGCCTGT
ACCGCCATACCTACATTCAGGAATATGACACTCCGGGCGGCGAGCCAATCGGTTCTGTGATTTCCAACTA
CGAGTTTGACGCGTCGGCGCAAGATGTCGCCCTGCTGCGTAACATTTCTAAAGTATCTGCCGCTGCGCAT
ATGCCATTCGTCGGTGCGGTCGGCCCTAAATTCTTCCTGAAAGATTCCATGGAAGAAGTGGCGGCGATTA
AAGATATCGGCAACTACTTTGACCGTGCGGAATACATCAAGTGGAAATCCTTCCGCGATTCTGACGATTC
CCGCTATATCGGTCTGACCATGCCGCGCGTACTCGGTCGCCTGCCGTATGGTCCGGATACCGTTCCTGTT
CGCAGCTTCAACTACGTTGAAGAAGTGAAAGGTCCGGATCACGAGAAATATCTGTGGACAAACGCGGCGT
TCGCCTTTGCGGCCAACATGGTGAAAAGCTTCATCAAAAATGGCTGGTGTGTGCAAATCCGTGGCCCACA
GGCGGGCGGTGCAGTGACTGATCTGCCGATCCATCTGTACGATCTCGGCACCGGCAATCAGGTGAAAATC
CCGTCAGAAGTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAATCTGGGCTTTATCCCGCTGTCTT
ACTACAAAAACCGCGATTACTCCTGCTTCTTCTCCGCGAACTCTGCGCAGAAACCGGCGCTGTACGATAC
TGCCAATGCCACTGCAAACAGCCGCATCAATGCACGCCTGCCGTACATCTTCCTGCTTTCACGCATCGCA
CACTACCTGAAGCTGATTCAGCGGGAAAATATCGGCACCACCAAAGACCGTCGTCTGCTGGAACTGGAAC
TGAACACCTGGATCCGTACGCTGGTCACTGAAATGACTGACCCGGGCGACGACCTGCAAGCCTCTCACCC
GCTGCGTGACGCCAAAGTGACCGTCGAAGATATCGAAGACAACCCGGGCTTCTTCCGCGTGAAACTGTAC
GCCGTACCGCACTTCCAGGTGGAAGGGATGGACGTGAATCTGTCACTGGTTTCTCAGATGCCTAAAGCGA
AAGCGTAA