SecReT6
Protein ID: 384527699
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23346
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]123494..124807 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDH8NZY7
KEGG IDraa:Q7S_23346
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.80E-127, Aligned region: 6..434
Protein Sequence: 437 a.a.     [Download]
>gi|384527699|ref|YP_005418931.1| type VI secretion protein [Rahnella aquatilis HX2]
MLSPQQFQQQALWEAHSNQCVAHLSVVNPWGVATAEFDEGLLSVRRLQALQLTVRLPDGSLIDTGSSDLL
PPARDLSQDIPAQVNELTVMLAMPLLQANSSNVQLTDNAGDRPLRYRQEWVKVQDAFGQEEESMAVARYA
LSLRFDIEQNEEYLICPVLRLVRDGQGGWRNDNTFIPPLLAMSAHHGLVLDMEQILTQLQAKRRRLMGMR
RESNQRMADFAVADVSLFWLLNALNTHVSALSELVKNPARHPEQVWFELSKLAGSLLTFSLEHDIEAIPA
YDHASPETVFPPLLDLIGELLEASLPSRVISLEMHKINGQQWKAPLNDSRLREDADFYLSVRSTLPAYQL
ISQFPALCKVGAPDDVNNIVNVALNGVPLIALSHVPAAIPLRLENQYFALDLKHPSAQAMLDSGTCMFYV
PELLGELQLELYAVLRS
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|384527587|ref|NC_017060.1|:123494-124807 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
TTGCTGTCCCCTCAGCAGTTCCAGCAGCAGGCTTTATGGGAAGCACATAGTAATCAATGTGTTGCCCACC
TGTCCGTTGTTAATCCCTGGGGCGTAGCCACAGCTGAGTTTGATGAAGGCTTGCTGAGTGTCAGACGCCT
GCAAGCACTACAGCTGACCGTGCGTCTGCCTGACGGTTCTCTGATAGATACCGGGAGCAGCGATCTTCTC
CCCCCTGCCCGGGATTTATCTCAGGATATTCCGGCACAAGTCAATGAGCTTACGGTGATGCTGGCGATGC
CGTTATTGCAGGCAAACAGCAGCAACGTGCAACTCACTGACAACGCAGGGGATCGCCCGCTTCGTTATCG
TCAGGAATGGGTGAAGGTTCAGGATGCATTCGGTCAGGAAGAAGAGTCCATGGCGGTGGCCCGTTATGCC
TTGTCTCTGCGTTTTGACATAGAACAGAACGAGGAATACCTGATCTGTCCTGTATTACGTCTGGTTCGCG
ACGGTCAAGGCGGCTGGAGAAATGACAATACGTTTATTCCTCCGTTGCTGGCAATGTCCGCTCATCACGG
GCTGGTATTGGACATGGAACAAATTCTCACACAATTACAGGCTAAACGCCGCCGCCTGATGGGCATGCGC
CGTGAGAGCAATCAGCGTATGGCCGATTTTGCCGTCGCAGATGTATCACTGTTCTGGCTGCTTAATGCCC
TCAATACGCACGTTTCGGCATTATCTGAACTGGTTAAAAATCCGGCGCGACACCCTGAACAAGTCTGGTT
TGAATTATCGAAACTGGCGGGGAGTCTGCTGACGTTTTCCCTGGAACATGATATCGAAGCGATACCGGCT
TACGACCATGCGTCCCCAGAGACCGTTTTCCCGCCTTTACTTGACCTGATCGGGGAGCTACTGGAAGCCA
GCCTTCCCTCGCGCGTTATCTCGCTGGAAATGCACAAGATCAATGGCCAGCAGTGGAAAGCGCCTCTTAA
TGACAGTCGCCTGCGTGAAGACGCGGACTTCTACCTGTCAGTGCGCTCAACACTGCCCGCTTATCAGCTG
ATTTCCCAGTTCCCTGCCTTGTGTAAAGTCGGGGCTCCGGACGATGTCAATAATATTGTTAACGTCGCAC
TTAATGGCGTGCCACTGATCGCTTTAAGCCATGTCCCTGCGGCAATCCCTCTTCGGCTGGAAAATCAATA
TTTCGCCCTGGATCTCAAACATCCCTCTGCGCAGGCCATGCTGGATTCAGGTACGTGCATGTTCTATGTA
CCGGAACTTCTCGGTGAACTGCAACTGGAACTCTATGCGGTGCTTCGGTCATGA