SecReT6
Protein ID: 384527700
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23351
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]124804..125478 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDH8NZY8
KEGG IDraa:Q7S_23351
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-46, Aligned region: 7..212
Protein Sequence: 224 a.a.     [Download]
>gi|384527700|ref|YP_005418932.1| DotU family type IV / VI secretion system protein [Rahnella aquatilis HX2]
MRNEIDIDELLADTWLSVVQLRNGVVAEEGEALYERCRAQVERVQDQLQLAGYDSESVEHITYAQCALLD
ETALGRQGEDTAPDNGHIAWQRAPLQARFFGSLQAGEALYERIRSVLRQPAPDITVLSCFHRVLLLGFQG
QYSAQTINPQQREQTLAALAGRVTPFNVVLPGALLSKTGRVRGGALFRSLWFWVLVAIVIVSGVWWGGHV
WLQHLINQQLPGQF
 
Nucleotide Sequence: 675 bp     [Download]
>gi|384527587|ref|NC_017060.1|:124804-125478 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGAGAAATGAAATAGATATTGATGAGTTACTGGCCGATACCTGGCTATCCGTTGTGCAGTTACGTAACG
GCGTGGTTGCAGAAGAAGGCGAAGCTTTATACGAGCGCTGCCGCGCTCAGGTAGAGCGAGTTCAGGACCA
ATTACAGCTGGCCGGTTACGATAGCGAAAGCGTTGAACATATCACTTATGCCCAATGTGCATTGCTGGAT
GAAACCGCACTCGGTCGACAGGGTGAGGACACGGCCCCTGATAACGGACATATTGCCTGGCAGCGGGCAC
CGTTACAGGCACGTTTCTTTGGCTCTCTTCAGGCAGGTGAAGCGTTATATGAACGGATCCGCTCTGTGCT
GCGTCAACCGGCTCCCGATATCACTGTGCTGAGCTGTTTTCATCGGGTCTTATTGCTGGGCTTTCAGGGG
CAATATAGCGCTCAAACCATCAACCCTCAGCAACGTGAGCAAACCCTCGCCGCACTTGCCGGGCGGGTCA
CGCCCTTCAACGTGGTGCTCCCGGGTGCATTGCTCAGTAAAACAGGACGGGTACGTGGCGGGGCATTATT
CCGCTCACTCTGGTTCTGGGTTCTGGTTGCTATTGTGATCGTGTCCGGTGTCTGGTGGGGCGGGCATGTC
TGGCTGCAACATCTGATTAATCAGCAATTGCCGGGGCAGTTCTGA