SecReT6
Protein ID: 384527703
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23366
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]127843..130497 [+]
Producttype VI secretion ATPase, ClpV1 family protein
NoteTssH
UniProt IDH8NZZ1
KEGG IDraa:Q7S_23366
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.70E-41, Aligned region: 239..259
AAA_2 [PF07724], Evalue: 6.70E-41, Aligned region: 613..777
AAA [PF00004], Evalue: 5.70E-19, Aligned region: 241..353
AAA [PF00004], Evalue: 5.70E-19, Aligned region: 618..738
AAA_5 [PF07728], Evalue: 5.40E-15, Aligned region: 241..265
AAA_5 [PF07728], Evalue: 5.40E-15, Aligned region: 617..737
ClpB_D2-small [PF10431], Evalue: 5.70E-13, Aligned region: 386..410
ClpB_D2-small [PF10431], Evalue: 5.70E-13, Aligned region: 784..856
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 99..200
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 218..262
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 286..319
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 492..509
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 587..661
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 681..711
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 756..802
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 240..326
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 616..638
AAA_25 [PF13481], Evalue: 4.50E-07, Aligned region: 241..265
AAA_25 [PF13481], Evalue: 4.50E-07, Aligned region: 294..329
AAA_25 [PF13481], Evalue: 4.50E-07, Aligned region: 491..541
AAA_25 [PF13481], Evalue: 4.50E-07, Aligned region: 615..646
Arch_ATPase [PF01637], Evalue: 1.20E-06, Aligned region: 219..257
Arch_ATPase [PF01637], Evalue: 1.20E-06, Aligned region: 293..391
Arch_ATPase [PF01637], Evalue: 1.20E-06, Aligned region: 611..634
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 241..373
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 517..537
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 616..653
NACHT [PF05729], Evalue: 3.70E-06, Aligned region: 241..338
NACHT [PF05729], Evalue: 3.70E-06, Aligned region: 617..641
IstB_IS21 [PF01695], Evalue: 9.40E-06, Aligned region: 235..301
IstB_IS21 [PF01695], Evalue: 9.40E-06, Aligned region: 617..635
AAA_14 [PF13173], Evalue: 1.10E-05, Aligned region: 241..342
AAA_14 [PF13173], Evalue: 1.10E-05, Aligned region: 616..707
AAA_19 [PF13245], Evalue: 2.40E-05, Aligned region: 238..261
AAA_19 [PF13245], Evalue: 2.40E-05, Aligned region: 615..639
AAA_23 [PF13476], Evalue: 4.60E-05, Aligned region: 241..259
AAA_23 [PF13476], Evalue: 4.60E-05, Aligned region: 451..537
AAA_23 [PF13476], Evalue: 4.60E-05, Aligned region: 615..641
Zeta_toxin [PF06414], Evalue: 7.60E-05, Aligned region: 235..265
Zeta_toxin [PF06414], Evalue: 7.60E-05, Aligned region: 616..657
Sigma54_activat [PF00158], Evalue: 8.10E-05, Aligned region: 224..255
Sigma54_activat [PF00158], Evalue: 8.10E-05, Aligned region: 616..734
DUF258 [PF03193], Evalue: 0.00085, Aligned region: 162..214
DUF258 [PF03193], Evalue: 0.00085, Aligned region: 224..258
DUF258 [PF03193], Evalue: 0.00085, Aligned region: 617..629
SRP54 [PF00448], Evalue: 0.002, Aligned region: 241..263
SRP54 [PF00448], Evalue: 0.002, Aligned region: 616..662
Clp_N [PF02861], Evalue: 0.0022, Aligned region: 23..66
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 241..267
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 618..642
RNA_helicase [PF00910], Evalue: 0.0045, Aligned region: 242..263
RNA_helicase [PF00910], Evalue: 0.0045, Aligned region: 618..639
AAA_33 [PF13671], Evalue: 0.0055, Aligned region: 241..258
AAA_33 [PF13671], Evalue: 0.0055, Aligned region: 616..635
AAA_33 [PF13671], Evalue: 0.0055, Aligned region: 749..808
AAA_29 [PF13555], Evalue: 0.0076, Aligned region: 235..257
AAA_29 [PF13555], Evalue: 0.0076, Aligned region: 615..628
Protein Sequence: 884 a.a.     [Download]
>gi|384527703|ref|YP_005418935.1| type VI secretion ATPase, ClpV1 family protein [Rahnella aquatilis HX2]
MEHQSAVLLRRLNPYCAKALEAAATLCQTRAHNEITVEHWLLKLLELGEGDITVLARRYEWDMDALWQSL
LAHLDALPRSVHSRPQLSQDLQSLMKAGWLAASLQDDNQSIRSVNLLEALMAQPRLLRCEGLWPLFSLSE
EHIRRLKPVLDALSEERPELQRQESLSRTPSALSENSATQNAESGVTGQSLSEALQAALDKFTLDVTAKA
KAGQIDPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRISEGNVPDSLKTVSLRTLDL
GLLQAGAGVKGEFEQRLKNVIDAVQKSPTPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIA
ATTWSEYKQYFERDAALERRFQIVKVDEPDDEMACLMLRGLKSRYAQHHGVHITDEAVKAAVSLSRRYIT
GRQLPDKAVDLLDTASARVRMSLDTLPEELTRLKAQIAALGMEEQALLEDIALGSQSHGERLEKIGELER
ELNAQLSALEAQYEAEKALTHKLLEIRQDISRQEDIHALQQELAQLQGSAPLLSLDVDVRTVATVIADWT
GVPLTSLLKDEQTDLLQLENHLGKRVVGQDHALTDMAQRLRAAKTGLTSENGPLGVFLLVGPSGVGKTET
ALSLADCLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHR
DVINLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHIMQLLDEQPEATDSDLQELLRPILRDHFQP
ALLARFQTLIYRPLNAVALRTIVEMKLAQVAKRRNKHYGLTCSIEESLYDTLVAACLLPDTGARNIDSLL
NQQILPVLSQQLLQRMAGQQPTTALALGWDEDEGITLEFDGEQK
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|384527587|ref|NC_017060.1|:127843-130497 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGAACATCAGTCAGCTGTCTTACTTCGCCGCTTAAATCCGTACTGCGCGAAAGCGCTGGAAGCCGCCG
CGACGCTCTGCCAGACCCGCGCCCACAATGAAATTACCGTCGAGCACTGGTTGCTCAAACTGCTGGAACT
GGGCGAAGGCGACATCACCGTGCTGGCCCGCCGCTATGAATGGGATATGGATGCGCTGTGGCAAAGCCTG
CTGGCACATCTCGATGCCCTGCCGCGTTCCGTGCATTCGCGTCCGCAGCTTTCCCAAGATTTACAATCGC
TGATGAAAGCGGGCTGGCTGGCCGCATCGCTGCAGGATGACAACCAGAGCATCCGCAGTGTCAATCTGCT
GGAAGCGCTGATGGCGCAACCACGCCTGTTGCGCTGCGAAGGTTTATGGCCGCTGTTCAGCCTGAGCGAA
GAACATATCCGTCGCCTCAAGCCCGTGCTGGATGCCTTGTCCGAAGAGCGCCCGGAGCTGCAACGACAGG
AAAGCCTTAGCCGCACGCCTTCCGCACTTTCTGAAAACTCAGCGACACAAAATGCAGAGTCTGGTGTTAC
CGGCCAGTCGTTAAGCGAAGCATTGCAGGCCGCGCTCGATAAATTCACGCTGGATGTCACCGCGAAAGCT
AAAGCCGGACAGATTGATCCGGTGTTTGGTCGCGATAACGAGATCCGTCAGATGGTGGACATTCTGTCCC
GTCGTCGCAAAAACAACCCGATTTTAGTCGGTGAACCGGGCGTCGGTAAGACCGCGCTGGTGGAAGGTCT
TGCACTGCGCATCAGTGAAGGCAACGTGCCGGACAGCCTGAAAACCGTCAGCCTGCGCACGCTGGATTTA
GGTCTGCTACAGGCCGGTGCCGGAGTAAAAGGCGAGTTCGAGCAACGCCTGAAAAACGTCATCGACGCCG
TGCAAAAATCACCCACACCGGTTCTGCTGTTTATCGATGAAGCGCACACTATTATTGGCGCTGGCAATCA
GGCCGGTGGCGCCGACGCTGCTAACCTGCTCAAACCCGCTCTCGCCCGTGGTGAATTGCGCACCATCGCC
GCCACGACCTGGTCTGAGTACAAACAGTATTTTGAGCGCGATGCCGCCCTTGAGCGCCGCTTCCAGATTG
TCAAAGTCGATGAGCCGGACGACGAGATGGCCTGCCTGATGCTGCGCGGCCTGAAATCCCGCTACGCGCA
GCACCACGGCGTTCACATCACCGACGAAGCCGTCAAAGCCGCCGTCAGCCTTTCCCGCCGCTACATCACC
GGCCGCCAGCTGCCGGACAAAGCCGTTGACCTGCTCGATACCGCGTCCGCCCGTGTACGCATGAGCCTCG
ATACCCTGCCGGAAGAGCTGACCCGCCTTAAGGCGCAGATAGCCGCACTGGGAATGGAGGAGCAGGCATT
GCTGGAAGATATCGCGCTCGGCAGCCAGAGCCACGGCGAACGTCTGGAGAAAATTGGCGAACTTGAGCGC
GAACTCAATGCCCAGCTTTCCGCTCTCGAAGCGCAGTACGAAGCCGAAAAAGCCCTGACGCATAAGCTGC
TGGAAATCCGTCAGGACATCAGCCGTCAGGAAGATATTCACGCGCTGCAACAAGAACTGGCTCAGTTGCA
GGGCAGCGCCCCGCTGCTGTCTCTTGACGTGGACGTCCGCACCGTTGCGACAGTCATTGCCGACTGGACC
GGCGTGCCGCTGACCAGCCTGCTGAAGGACGAACAGACTGACCTGTTGCAACTGGAAAACCATCTGGGCA
AACGTGTCGTCGGACAGGATCATGCGCTGACCGACATGGCGCAACGCCTGCGTGCCGCCAAAACCGGCCT
GACGTCTGAGAATGGCCCGCTGGGCGTCTTCCTGCTGGTCGGTCCGAGCGGTGTCGGTAAAACGGAAACC
GCACTTTCCCTCGCGGACTGCCTGTTCGGCGGCGAGAAATCCCTTATCACCATTAACCTCAGCGAATACC
AGGAAGCGCACACCGTATCCCAGCTGAAAGGCTCACCTCCGGGATACGTCGGTTACGGTCAGGGCGGTAT
TCTGACGGAAGCCGTGCGTAAACGACCGTACAGCGTCGTCCTGCTTGATGAAGTGGAAAAAGCCCACCGG
GATGTCATTAACCTGTTCTATCAGGTATTCGACCGCGGCTTTATGCGAGATGGTGAAGGCCGCGAAATCG
ACTTCCGTAACACCGTCATTCTGATGACTGCGAATCTGGGCAGCGACCACATCATGCAGTTGCTGGATGA
ACAGCCGGAAGCCACCGACAGCGATTTGCAGGAACTGCTGCGCCCGATCCTGCGCGATCATTTCCAGCCC
GCCCTGCTCGCCCGTTTCCAGACGCTGATTTATCGTCCGCTGAATGCCGTTGCCCTGCGCACTATCGTTG
AGATGAAACTGGCACAAGTCGCGAAACGTCGGAACAAGCACTATGGCCTGACCTGCTCCATAGAAGAAAG
TCTGTACGACACGCTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCCCGCAACATCGACAGCCTGCTC
AATCAGCAGATACTGCCGGTGCTGAGCCAGCAACTGCTGCAGCGCATGGCCGGGCAACAGCCCACTACTG
CGCTGGCGCTGGGCTGGGATGAAGACGAAGGGATCACGCTGGAATTTGACGGAGAACAGAAATGA