SecReT6
Protein ID: 384527713
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23416
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]143619..145388 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDH8P001
KEGG IDraa:Q7S_23416
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-182, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|384527713|ref|YP_005418945.1| type VI secretion system protein ImpG [Rahnella aquatilis HX2]
MDDLTLRYYEAEMRYLREAGREFAHAHPDRAAMLNLDKSGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLAIVELKPDYRQLKQVEIVPRGFSVLSQPVGQKHTCCQYQVTRDMPLMPIN
ISQAKLHTETDGRSTVRLRFDCGPLADWRKIDLSRVAIYLDADSPVSSALHLALTRKVQTMYVRQPELGQ
DRRAIDGWFKPMGFEENERLWPKGSSAFSGYQLLLEYFTFRPKFMFVELNGLQNVHLVPGTTWFELDIVL
SELWPYDLPFDTDTFRLHCVPVINLFSLEADPLQIDPLANEYLLRPLRMQDGHVEIYSVDQVHGSVKNGK
HDYVPFTSFRHRGGMMRHDAPERYFHTRVKRGPSGLHDTWLILGGKSFEAEQLAEQREALSLRITGTNGQ
LPRKALESTLLNRVVKAGKVPVQVRNLTTPTMPVYPPANDRFHWRGMSHLGSSFLSMMDNPEVLRGTLAL
YDWTDDEMNCRRLEAIVAVEHHLIQRFEKGFMLRGVDIEITLNTDNFAGEGDVNLFGEMLHRFFALYADI
HLFNQLTLVLQPTGKRLRWNENHSQHVPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|384527587|ref|NC_017060.1|:143619-145388 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGATGATTTGACCCTGCGCTATTACGAAGCTGAGATGCGTTACCTGCGCGAGGCCGGGCGCGAATTTG
CCCATGCCCATCCCGACCGGGCCGCGATGCTCAACCTGGATAAGTCCGGGGCGCGCGATCCGTACGTTGA
ACGTTTATTTGAAGGTTTCGCATTTCTGATGGGGCGTCTGCGGGAGAAACTGGACGATGACCTGCCGGAA
CTCACAGAGGGACTGGTCAGCCTCTTGTGGCCACACTATATGCGGACAATCCCTTCACTGGCCATTGTTG
AATTGAAACCTGATTACCGGCAACTCAAGCAGGTGGAGATCGTGCCCCGGGGCTTCTCTGTCCTGTCACA
GCCTGTCGGGCAAAAACACACCTGCTGCCAGTATCAGGTGACGCGGGATATGCCGCTTATGCCGATCAAT
ATTTCACAGGCGAAGTTGCATACTGAAACAGACGGGCGTTCAACCGTACGCCTGCGTTTTGACTGCGGTC
CGCTGGCGGACTGGCGAAAGATAGATTTAAGCCGCGTGGCAATCTATCTCGATGCCGACAGTCCGGTCAG
CAGTGCTTTGCATCTGGCCCTGACCCGCAAAGTGCAGACCATGTATGTCCGCCAGCCGGAGTTGGGTCAG
GATCGCCGTGCGATAGACGGCTGGTTCAAGCCCATGGGATTTGAAGAAAATGAACGCCTGTGGCCTAAAG
GGAGCTCGGCGTTCAGTGGCTATCAGTTGTTACTGGAATACTTTACCTTCCGCCCAAAATTTATGTTCGT
TGAGCTGAATGGACTGCAAAATGTCCATCTGGTACCGGGGACGACATGGTTCGAACTCGATATTGTTTTG
AGTGAGTTGTGGCCTTATGACCTGCCGTTTGATACCGATACCTTCCGGTTACACTGCGTTCCGGTCATTA
ACCTGTTTTCACTGGAAGCCGACCCGCTGCAAATTGATCCACTGGCGAATGAATATCTTTTGCGGCCACT
GCGAATGCAGGATGGTCACGTAGAAATCTACAGTGTTGATCAGGTACACGGTTCCGTTAAAAACGGCAAA
CACGACTACGTGCCCTTCACCAGTTTCCGTCACCGCGGGGGCATGATGCGTCATGATGCTCCCGAACGCT
ATTTCCACACACGTGTTAAGCGCGGGCCTTCTGGCTTGCATGACACATGGTTAATTCTCGGCGGTAAATC
CTTTGAAGCAGAACAGCTTGCTGAACAGCGTGAAGCACTTTCACTGCGTATTACCGGGACCAACGGCCAG
CTTCCACGTAAGGCGCTGGAAAGTACCCTGCTCAACCGGGTTGTGAAAGCCGGCAAAGTCCCGGTACAAG
TTCGCAACCTCACCACGCCTACCATGCCGGTATATCCGCCTGCCAATGATCGCTTCCACTGGCGGGGGAT
GAGTCACCTGGGTTCAAGCTTCCTCAGCATGATGGATAACCCAGAGGTGCTGCGAGGCACGCTGGCGCTG
TATGACTGGACCGATGATGAAATGAACTGCCGCAGGCTCGAGGCGATTGTTGCCGTCGAACACCACCTGA
TCCAGCGATTTGAAAAAGGGTTCATGCTGCGCGGTGTCGATATAGAAATCACCCTGAATACAGACAACTT
CGCGGGTGAAGGGGACGTCAATCTCTTTGGTGAAATGCTGCACCGCTTCTTTGCCTTGTACGCCGATATT
CACCTTTTCAATCAGCTGACGCTGGTGTTGCAACCGACAGGAAAACGCCTGAGATGGAACGAGAATCACA
GCCAACACGTACCGGGCTGA