SecReT6
Protein ID: 384527714
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23421
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]145352..146434 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDH8P002
KEGG IDraa:Q7S_23421
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-79, Aligned region: 20..321
Protein Sequence: 360 a.a.     [Download]
>gi|384527714|ref|YP_005418946.1| type VI secretion protein [Rahnella aquatilis HX2]
MERESQPTRTGLIDALSPQAPYLNFYRFCQLLEQAGGEAPLLGTTSTPATDPIRFRPHPGMGFPVSEIRA
IEADREHIHATPTVRTTFMGLYGVDAPLPTGYLDDISQRREGYESVEHFLDIFNHRLMTQFYRIWRKYAY
PASFQAGGTDETSQCLLGLIGLGIPGTAKHIATPISRFLALLSTMRLPTRTAEGIRALVNLLAPRTQAYI
QGHDPVSVEMRTRSGFCAENRVALAQRSVLGRKGKDGNSRVLVSLMTSDPEEAEGWLPGGHLHTDLLVMM
RVYLGYRCNARLQLTVPTRLLPEPRLGGSRRIQLGRTGVLGLQESKRDSLPQSMTVSLGTYQGVHEEPLL
PAESGEYRFR
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|384527587|ref|NC_017060.1|:145352-146434 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGAACGAGAATCACAGCCAACACGTACCGGGCTGATCGATGCCCTGAGTCCGCAGGCGCCCTATCTGA
ATTTTTACCGGTTTTGTCAGCTTCTGGAACAGGCTGGCGGGGAAGCTCCGCTGCTCGGTACAACCAGCAC
TCCCGCAACAGATCCAATACGTTTTCGCCCGCATCCTGGCATGGGTTTTCCGGTCAGCGAAATACGCGCC
ATAGAAGCCGACCGGGAACATATACACGCCACACCCACTGTTCGCACCACCTTTATGGGGCTCTATGGGG
TAGATGCCCCCTTACCCACAGGCTATCTCGACGATATCAGCCAACGGCGGGAAGGATACGAAAGCGTTGA
GCATTTTCTGGATATTTTCAACCATCGGCTGATGACGCAGTTCTATCGCATCTGGCGTAAATACGCCTAC
CCCGCTAGTTTCCAGGCTGGCGGAACGGATGAGACATCACAGTGCCTGCTCGGTCTGATTGGTCTGGGGA
TACCCGGCACGGCCAAACATATCGCGACGCCGATTTCCCGATTTCTGGCGCTTTTAAGCACTATGCGTTT
GCCGACACGAACGGCAGAAGGGATCCGTGCACTGGTGAATCTGCTGGCACCGCGAACGCAGGCTTATATT
CAGGGGCATGACCCGGTGTCAGTAGAAATGCGTACTCGCAGCGGGTTTTGCGCTGAAAACCGTGTTGCGC
TGGCACAGCGCAGCGTACTGGGCCGCAAAGGAAAAGACGGTAATAGCCGGGTACTGGTGAGTCTGATGAC
CTCCGATCCTGAAGAAGCTGAAGGATGGTTACCCGGCGGCCATTTGCATACCGATTTACTTGTGATGATG
CGGGTATATCTCGGCTACCGGTGCAATGCCCGCCTGCAACTCACCGTCCCTACCCGCTTGCTGCCGGAGC
CCCGGCTCGGTGGGTCCCGACGGATACAGCTCGGGCGTACCGGTGTGCTGGGTTTACAGGAAAGCAAACG
TGACAGCCTGCCGCAAAGTATGACCGTCAGCCTCGGCACCTATCAGGGTGTACATGAAGAACCCTTGCTA
CCCGCTGAGTCGGGAGAATACCGGTTCCGTTAA