SecReT6
Protein ID: 384527715
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23426
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]146498..147040 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDH8P003
KEGG IDraa:Q7S_23426
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.70E-37, Aligned region: 20..171
Protein Sequence: 180 a.a.     [Download]
>gi|384527715|ref|YP_005418947.1| type VI secretion lipoprotein [Rahnella aquatilis HX2]
MAKIISSPTRWQYFSLFLLAVLLSGCGLTQKVVDGTKGVTKAIFYKQIKTLHLDFSPRTSMNTDEGDQSS
LATMVRVYQLKDRKAFDAADYEKLLLQADNLLKADALASKEVLVMPGGDVSLDMPMEPDAQFVAVVALFR
NPDRQHDTWRVVLKREELDPDKPRTLELSNGQLTLLPLKD
 
Nucleotide Sequence: 543 bp     [Download]
>gi|384527587|ref|NC_017060.1|:146498-147040 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGCAAAAATAATTTCCTCACCTACAAGATGGCAGTATTTCAGCCTGTTTCTGCTCGCGGTTCTGCTTA
GCGGATGTGGCCTGACTCAGAAAGTGGTCGATGGCACCAAAGGCGTGACCAAAGCGATTTTCTATAAGCA
AATTAAAACACTGCATCTCGATTTTTCCCCGCGCACTTCTATGAACACAGATGAAGGCGATCAGTCATCA
CTTGCCACCATGGTGCGTGTTTATCAGCTTAAAGATCGCAAAGCCTTTGACGCTGCGGATTATGAAAAGC
TGCTGCTTCAGGCCGACAACCTGTTAAAAGCCGATGCCCTGGCCTCTAAGGAAGTGCTGGTGATGCCGGG
CGGTGATGTATCACTGGATATGCCCATGGAACCCGATGCTCAGTTTGTCGCCGTGGTGGCGTTGTTTCGC
AACCCGGACAGACAACATGATACCTGGCGGGTGGTCCTGAAACGGGAAGAGCTTGATCCCGACAAGCCCC
GCACGCTGGAACTCAGTAACGGGCAGCTTACGTTGTTACCACTCAAAGATTAA