SecReT6
Protein ID: 384527719
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23466
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]154352..155956 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDH8P007
KEGG IDraa:Q7S_23466
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 67..127
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 158..183
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 242..261
Protein Sequence: 534 a.a.     [Download]
>gi|384527719|ref|YP_005418951.1| type VI secretion-associated protein [Rahnella aquatilis HX2]
MATLHTLLALCPQENPDILMQKAKVQTALWEKWLNPVSSDNATGEDPGYDDDFQRMREEVNKLSGADTEL
VCQLAEKLLTTVCKDVRVATYYLWARLHRDGESGLAEGLELLSGLVSRYGDQLLPSRKNSRRAAMEWLAG
SKVLDSLSLYPEVDKPKFERILAALTLFEYVITSWEDANRPQLGGLYDALESRLAQSGGFDAVVPQNSGG
QATSDSRSISPDMPTLKVIQSGRELLDQAKALAQYLRDQPQGWLSGHRLMTTIRWDTVDQLPPLDAKGCT
RLVPPRTDYRAQLKRLYLQQSWSELLENADRMFTEGVNHFWLDIQWYLHQALSKSGAPYDSWAEFIEQDL
RLLLLRLPGLETLAYSDGTPFADEVTAGWIARDIQDNDGRWQSEPNAVSASGDEDVLQLETEALAQADGE
GIEAALNWLQIRPGITTPRQRWLIRLLMARVAEQYGKNEMALHLLGELDSTGNSLTLKQWEPALLFEVKA
RRLKLLRMQFQRGDTDKAKLILEMDTLLAGLVSIDPARAAVLCA
 
Nucleotide Sequence: 1605 bp     [Download]
>gi|384527587|ref|NC_017060.1|:154352-155956 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGCCACATTACACACCCTGTTAGCGCTATGCCCACAGGAAAACCCAGATATATTGATGCAAAAGGCCA
AAGTGCAAACGGCGCTGTGGGAAAAATGGCTAAACCCGGTTAGCAGCGATAACGCAACTGGTGAAGATCC
CGGTTATGACGATGATTTTCAACGTATGCGTGAAGAAGTTAATAAGCTTTCAGGCGCGGATACTGAACTG
GTATGCCAGCTGGCGGAGAAATTACTGACCACTGTATGCAAAGACGTAAGGGTGGCCACTTATTACCTCT
GGGCACGATTGCATCGCGACGGCGAATCGGGTCTGGCCGAAGGGTTGGAGCTGTTGAGCGGACTGGTCTC
ACGCTATGGCGACCAGTTGTTGCCATCACGAAAAAATAGCAGGCGGGCTGCCATGGAGTGGCTGGCAGGA
AGTAAAGTCCTCGACAGCCTTTCGCTGTATCCCGAAGTCGATAAGCCAAAGTTTGAACGCATTTTGGCTG
CACTCACCCTGTTTGAATACGTTATTACATCATGGGAAGACGCAAACCGACCACAGTTGGGCGGTCTTTA
TGATGCCCTTGAATCCCGACTGGCTCAGTCTGGTGGCTTCGATGCCGTTGTTCCGCAAAATAGCGGCGGT
CAGGCAACGTCTGATTCGCGCTCCATCTCGCCGGACATGCCGACATTAAAGGTAATACAGTCTGGTCGTG
AGTTACTCGATCAGGCTAAGGCGTTAGCTCAGTACCTGCGAGACCAGCCACAAGGCTGGCTATCAGGACA
CCGCTTGATGACTACAATACGCTGGGACACCGTCGACCAACTACCTCCGCTGGACGCTAAAGGTTGTACT
CGCCTGGTACCACCCCGTACTGACTACCGTGCCCAACTCAAACGCCTGTATCTGCAACAAAGCTGGAGCG
AATTACTGGAAAATGCAGATAGGATGTTTACTGAAGGCGTGAACCATTTCTGGCTGGATATTCAATGGTA
CTTGCACCAGGCACTCAGCAAGTCGGGGGCGCCTTATGATAGTTGGGCAGAATTTATCGAACAGGATCTG
CGGTTATTGCTGCTTCGTTTACCGGGACTGGAAACGCTGGCCTACAGTGACGGTACCCCCTTTGCAGACG
AAGTGACCGCAGGCTGGATCGCTCGTGATATTCAGGACAATGACGGGCGATGGCAATCTGAACCCAATGC
AGTCTCTGCAAGTGGCGATGAAGATGTTCTTCAGCTTGAAACCGAAGCACTGGCGCAGGCAGACGGTGAA
GGTATTGAAGCTGCACTCAATTGGTTGCAGATTCGCCCGGGGATCACTACACCTCGCCAACGTTGGCTAA
TACGGCTGCTCATGGCTCGTGTTGCTGAACAATATGGAAAAAATGAAATGGCACTCCACTTACTTGGAGA
ACTGGACAGCACAGGAAATAGCCTCACGCTGAAGCAATGGGAGCCGGCCCTGCTGTTTGAAGTAAAAGCA
CGACGACTCAAACTGCTGAGAATGCAATTCCAGCGCGGCGATACTGATAAAGCAAAACTCATCCTCGAAA
TGGACACGCTACTCGCCGGATTGGTTTCAATTGATCCTGCGCGCGCGGCAGTGCTTTGTGCTTAA