SecReT6
Protein ID: 384527722
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23481
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]157461..158855 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDH8P010
KEGG IDraa:Q7S_23481
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 9.80E-48, Aligned region: 113..147
DUF3702 [PF12486], Evalue: 9.80E-48, Aligned region: 302..449
ImpA-rel_N [PF06812], Evalue: 7.80E-21, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 7.80E-21, Aligned region: 356..373
Protein Sequence: 464 a.a.     [Download]
>gi|384527722|ref|YP_005418954.1| ImpA domain-containing protein [Rahnella aquatilis HX2]
MITQDKNRQLRTGDDPRALADYAVLREELSKLTHPARPDVDWKKVEHLCLNLFQQNGIELQTASWYTQAR
ARLAGMPGLNEGLAILEALISRQWPGLWPQPVHARMEILSGLSQRLQQILRGMSLEYHDLSQIYQAEKLI
ASLCNVLQRLELKHVSQLEALTSFMHGTAVRLENMHATSDAAIVLPAAAAEKAEKEWTAQPGEQWVYVAQ
SGPAEPQVIAPPSPVKRPVQWKGFIAGIVVTALAGTGFKAGMDAFYHPQTAEQLMATLPVLPKLLNAQTL
ETLKNQQAEMLHREAPAFLAATQQQTRQLAALPPRWAQDTGAQLVKQAQILWPDNPASQQLAKNWTQQLN
ASAIPLENLTGWQQANTQLQQLADKLNGLDEQRGKYMTVSQLKSSVFAIQQALNSSPPVEESLRKLAQDK
QQQKGISPQRIMQLDNQFTQLLNRYVLLLQNLPATTEKNGQADH
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|384527587|ref|NC_017060.1|:157461-158855 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGATAACCCAAGACAAAAACCGCCAGTTGCGCACCGGGGATGACCCGCGTGCGCTGGCTGATTACGCGG
TTTTACGCGAAGAACTGAGCAAATTAACCCATCCGGCGCGTCCCGATGTGGACTGGAAAAAGGTGGAACA
CCTGTGTCTGAACCTGTTCCAGCAAAACGGTATCGAGCTGCAAACGGCCTCCTGGTACACACAGGCCAGA
GCGCGGCTAGCGGGCATGCCGGGATTAAATGAAGGGCTGGCGATCCTCGAGGCATTAATTTCACGTCAGT
GGCCGGGACTGTGGCCGCAGCCGGTGCACGCGCGGATGGAAATTCTTTCGGGTCTGAGTCAGCGTCTTCA
GCAAATATTGCGCGGTATGTCACTGGAATATCATGATTTATCGCAGATTTATCAGGCAGAAAAACTGATC
GCTTCGCTTTGCAATGTGTTGCAACGCCTTGAACTGAAACACGTCAGCCAGCTGGAAGCACTGACTAGTT
TCATGCATGGTACTGCCGTCAGGCTGGAGAATATGCACGCGACCAGCGATGCAGCAATCGTTTTACCGGC
GGCAGCGGCAGAAAAAGCGGAAAAAGAGTGGACCGCGCAACCCGGTGAACAATGGGTGTATGTTGCGCAG
AGCGGACCTGCCGAACCGCAGGTGATTGCACCGCCTTCGCCAGTGAAACGTCCGGTGCAGTGGAAAGGGT
TTATCGCAGGTATCGTGGTGACGGCATTGGCCGGTACCGGTTTTAAAGCCGGGATGGATGCTTTTTATCA
TCCGCAAACGGCAGAGCAACTGATGGCGACGCTGCCGGTATTACCAAAATTGCTGAACGCACAGACGCTG
GAAACACTTAAGAACCAACAGGCTGAGATGCTCCACCGCGAGGCACCGGCATTTCTGGCCGCCACCCAAC
AGCAAACACGCCAGCTGGCAGCATTGCCGCCGCGCTGGGCACAGGACACCGGAGCACAACTGGTAAAACA
GGCGCAAATCCTCTGGCCGGATAACCCCGCATCTCAACAACTGGCAAAAAACTGGACACAACAGCTTAAC
GCCAGTGCGATACCGCTGGAAAACCTCACTGGCTGGCAACAGGCGAATACGCAGTTACAGCAACTGGCGG
ACAAACTCAACGGGCTGGATGAACAACGCGGTAAATACATGACCGTGTCGCAGCTAAAATCCTCGGTATT
CGCCATCCAGCAGGCGCTGAACAGTTCGCCGCCAGTCGAAGAATCGCTGCGCAAGCTGGCGCAGGATAAA
CAACAGCAAAAAGGCATATCCCCGCAACGGATTATGCAACTGGATAACCAGTTCACGCAGTTGCTGAACA
GGTATGTGTTGCTCCTCCAGAACTTACCGGCGACAACCGAAAAAAATGGTCAGGCAGATCACTAA