SecReT6
Protein ID: 384527928
SecReT6 ID562
T6SS typeN/A
Gene symbol-
Locus tagQ7S_24511
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]365085..366170 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDH8NZN1
KEGG IDraa:Q7S_24511
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-76, Aligned region: 40..336
Protein Sequence: 361 a.a.     [Download]
>gi|384527928|ref|YP_005419160.1| type VI secretion protein [Rahnella aquatilis HX2]
MAGTPPDAGVVLMMPDDFDDDVKKKENVLKEFWRDKDGNDRAHAFNFYRFCQLLEKQLSDNKPLGSTFSP
KNDAVRFRPHPGMGFPVSELKAVETSEERPDAPPTVRTTFMGLYGVDSPLPTGYIDDITQRREGHEALEA
FLDIFNHRMMTQFYRIWRKYNYPATFEEGGTDKTSRSLMALTGITDSGDVPASRLLALLQPLVRTTRTAE
GITSVIRSQAPNTQVTVKPHKVTRIPAGKRARFSFSAQQRLGDHLVLGSETSDANYCIGVEMFTEDPTEA
NGWLPGGQLREDVFTLLRVYLGCDYDASLTLTIPMKLAPLPRLGDRTLFAGYNVVLGLREDNLDKMPEQV
TMKLGRIRDKR
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|384527587|ref|NC_017060.1|:c366170-365085 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGCCGGAACGCCGCCTGACGCGGGTGTTGTTCTGATGATGCCAGATGATTTTGATGACGATGTAAAAA
AGAAAGAGAACGTCCTGAAGGAATTCTGGCGGGACAAGGACGGTAACGACCGGGCGCACGCCTTTAACTT
CTACCGTTTCTGCCAGCTGCTGGAAAAACAGCTCTCGGATAATAAACCTCTCGGCAGCACCTTCTCGCCG
AAAAATGACGCGGTGCGTTTTCGTCCGCATCCGGGGATGGGTTTTCCGGTCAGCGAGCTTAAAGCCGTCG
AAACGAGCGAAGAACGCCCGGACGCGCCGCCGACGGTGCGCACCACCTTTATGGGGCTGTACGGCGTGGA
TTCGCCGCTGCCGACCGGCTACATCGATGACATCACCCAGCGGCGCGAAGGTCACGAGGCGCTGGAAGCC
TTTTTAGACATCTTCAACCACCGGATGATGACGCAGTTTTACCGCATCTGGCGAAAGTACAATTATCCCG
CCACCTTTGAGGAAGGCGGGACCGACAAAACGTCGCGCAGCCTGATGGCCCTGACCGGCATCACCGACAG
CGGCGACGTGCCCGCCTCGCGATTGCTGGCGTTATTGCAGCCGCTGGTCAGAACTACCCGCACGGCGGAA
GGTATCACCAGCGTGATCCGCTCGCAGGCACCCAACACGCAGGTCACCGTAAAACCGCATAAGGTCACGC
GGATACCCGCCGGCAAACGTGCTAGATTCTCTTTCTCAGCTCAGCAACGCCTGGGCGACCATCTGGTTCT
CGGCAGTGAAACCTCGGATGCCAACTACTGCATTGGCGTGGAGATGTTTACCGAAGACCCAACTGAGGCC
AACGGCTGGCTGCCCGGCGGTCAGTTGCGGGAAGACGTCTTTACCCTGCTGCGCGTCTATCTGGGGTGTG
ACTACGACGCCAGCCTGACGCTGACCATTCCGATGAAGCTCGCACCGCTGCCGCGTCTGGGCGATCGCAC
TCTGTTCGCGGGTTACAACGTGGTGCTGGGATTGCGGGAAGATAATCTGGATAAAATGCCGGAACAGGTG
ACGATGAAACTGGGCAGAATCAGGGATAAGAGGTAA