SecReT6
Protein ID: 384527929
SecReT6 ID562
T6SS typeN/A
Gene symbol-
Locus tagQ7S_24516
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]366134..367909 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDH8NZN2
KEGG IDraa:Q7S_24516
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-120, Aligned region: 5..588
Protein Sequence: 591 a.a.     [Download]
>gi|384527929|ref|YP_005419161.1| type VI secretion protein [Rahnella aquatilis HX2]
MEDDFLKYFDGEMRYLKEAGLEFAKEFPELGRALGLDGSPVPRDDSVERLFQGFSLMMAKLRQKIDDDIP
ELTEPLLSHLLPVINRTLPSTAVVELTPVAPELHVREEVLPAESDLLTQPLGNDRQRCVYRTTRDLKVHP
FALDNVSLFTLQEGQQALKLRFTLPALTEIRRADWQNISLYLNGDRVLQSALYLALSRQVKRVNVRFWQK
STELMPVDVQFVPRWQAENDASIWPESDSPALCGEVRPWLEYFTSPARYFFMQLRGLETLTFPPDTTSFD
IEVTLSERWPYDLAVPPDAIRMHCVPVINLFRLLAQPLSVTTAVSDYRLRPHRLSDGHTEIYAVNDVAEV
TEDNAEFSYVPYSQFRQKGGMLQYKKNWPDRYYHTRMYRGPSGLNETILMLGGRTHEAQNGLKMRLNMTC
TNGAWPRMALQESVFDGETAPGNLELKCATRTRPTMPHYPPTAELYQWQVLSLLHPQAIAGLMETDTLRH
ALSLLDWTHDPDNARRVAGITHVEYTPSHYPAEGWHGVAIRVTLDEHHFCGQGDALLFCEVLEQFYTQYA
DIRRFTQLTVTLSQSGTQWAWPERRLTRVLF
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|384527587|ref|NC_017060.1|:c367909-366134 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGAAGACGATTTCTTAAAATATTTTGACGGCGAAATGCGCTACCTGAAGGAAGCCGGGCTGGAGTTTG
CGAAAGAGTTCCCGGAGCTGGGACGCGCGTTAGGTCTGGACGGCAGTCCGGTACCGCGCGATGACTCCGT
CGAACGGCTGTTTCAGGGCTTTTCGCTGATGATGGCCAAGCTGCGTCAGAAGATAGATGACGATATTCCC
GAGCTGACTGAGCCTCTGCTCTCGCACCTGCTGCCGGTGATCAACCGCACGCTGCCCTCCACGGCAGTGG
TCGAACTGACACCGGTCGCGCCGGAGCTGCATGTGCGCGAAGAGGTGTTGCCCGCTGAAAGCGATCTGTT
AACCCAGCCACTGGGCAACGACCGTCAGCGCTGCGTTTATCGCACCACCCGCGACCTGAAAGTCCATCCG
TTTGCGCTTGATAACGTCTCGTTATTCACCCTGCAGGAAGGCCAGCAGGCGCTGAAACTGCGCTTCACCC
TGCCCGCCCTCACTGAAATCCGCCGCGCCGACTGGCAAAACATCAGCCTGTATCTCAACGGCGACCGCGT
GCTGCAGTCAGCGCTGTATCTGGCCCTCAGCCGTCAGGTGAAGCGGGTGAACGTGCGGTTCTGGCAGAAA
TCGACAGAGCTGATGCCAGTAGACGTGCAGTTTGTGCCACGCTGGCAGGCAGAAAACGACGCCTCAATCT
GGCCGGAGAGCGACAGTCCGGCCCTGTGCGGCGAGGTGCGCCCGTGGCTGGAATATTTCACTTCACCGGC
GCGTTATTTCTTTATGCAGCTGCGCGGGCTGGAAACCCTGACCTTTCCGCCTGACACCACCTCGTTTGAT
ATCGAGGTGACGCTCAGCGAACGCTGGCCGTACGATCTGGCCGTGCCGCCGGACGCCATCCGCATGCACT
GCGTGCCGGTGATTAACCTGTTCCGCCTGCTGGCCCAGCCGCTCTCCGTGACCACCGCGGTCAGTGATTA
CCGCCTGCGACCACACCGGCTCAGCGACGGCCACACCGAAATCTATGCGGTCAATGACGTCGCGGAAGTG
ACTGAGGACAACGCCGAATTCAGCTACGTACCCTACAGCCAGTTTCGCCAGAAAGGCGGCATGCTCCAGT
ATAAGAAAAACTGGCCCGACCGTTATTACCACACCCGCATGTACCGGGGTCCTTCCGGACTGAACGAGAC
CATTTTAATGCTCGGTGGACGCACCCACGAGGCGCAGAACGGCCTGAAAATGCGCCTGAACATGACCTGT
ACCAACGGCGCCTGGCCGCGCATGGCGTTGCAGGAGAGCGTATTCGACGGCGAGACCGCCCCGGGTAATC
TTGAGCTGAAGTGTGCCACCCGCACGCGTCCCACTATGCCGCATTACCCGCCGACCGCTGAACTTTATCA
GTGGCAGGTGCTGTCGCTGCTGCATCCGCAGGCCATCGCCGGTCTGATGGAAACCGACACGCTGCGTCAC
GCGCTCAGCCTGCTGGACTGGACGCATGACCCGGACAACGCGCGCCGCGTTGCGGGCATTACGCACGTTG
AATACACACCGTCGCACTACCCCGCTGAAGGCTGGCACGGCGTGGCCATCCGCGTAACCTTGGATGAGCA
TCATTTCTGTGGCCAGGGCGATGCATTGCTGTTTTGCGAGGTTCTGGAGCAGTTCTACACCCAGTACGCC
GATATCCGCCGGTTCACACAGCTGACAGTCACGCTCAGTCAGTCCGGGACACAATGGGCATGGCCGGAAC
GCCGCCTGACGCGGGTGTTGTTCTGA