SecReT6
Protein ID: 384527930
SecReT6 ID562
T6SS typeN/A
Gene symbol-
Locus tagQ7S_24521
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]367909..368442 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDH8NZN3
KEGG IDraa:Q7S_24521
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-37, Aligned region: 20..170
Protein Sequence: 177 a.a.     [Download]
>gi|384527930|ref|YP_005419162.1| type VI secretion lipoprotein [Rahnella aquatilis HX2]
MTPDNFQRVRRGTVLLLLPLLISSCGLTQRVGSGASAVAEAVLYRKIDTLHLKLTSRAALNSNEGGEALP
TVVRVYQLKDRKTFDTASYAALLRQDNTVLAADLLDRQVVQVMPDAEATVAVPLHADAKFVAVVALFMAP
DATNNTWRLVLERNDLDDSKDRIVELNDNRLQLRKNQ
 
Nucleotide Sequence: 534 bp     [Download]
>gi|384527587|ref|NC_017060.1|:c368442-367909 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGACGCCCGATAATTTCCAGCGAGTAAGACGCGGCACCGTGCTGTTATTACTGCCCTTACTGATAAGCA
GCTGCGGCCTGACGCAGCGCGTGGGAAGCGGCGCCTCTGCGGTCGCAGAGGCCGTGCTCTACCGTAAAAT
AGACACCCTGCATCTGAAGCTGACCTCCCGCGCCGCGCTCAACAGCAACGAAGGCGGCGAGGCGCTGCCG
ACGGTGGTTCGCGTTTATCAGCTCAAAGACCGTAAAACCTTTGATACGGCCAGCTACGCCGCCCTGCTCA
GGCAGGACAACACCGTGCTGGCCGCTGACCTGCTCGACCGGCAGGTTGTCCAGGTGATGCCGGACGCAGA
GGCGACGGTGGCCGTGCCGCTGCATGCCGACGCAAAGTTTGTCGCCGTGGTGGCCCTCTTTATGGCACCG
GATGCCACAAACAACACCTGGCGGCTGGTTCTCGAACGTAATGACCTCGATGACAGTAAAGACCGGATCG
TTGAGCTCAATGACAACCGGCTGCAGCTCAGGAAAAATCAGTAA