SecReT6
Protein ID: 384527937
SecReT6 ID562
T6SS typeN/A
Gene symbol-
Locus tagQ7S_24566
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]377693..380200 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDH8P063
KEGG IDraa:Q7S_24566
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 3.50E-44, Aligned region: 613..761
Phage_GPD [PF05954], Evalue: 3.20E-39, Aligned region: 44..350
T6SS_Vgr [PF13296], Evalue: 3.60E-33, Aligned region: 491..596
Phage_base_V [PF04717], Evalue: 5.50E-12, Aligned region: 410..484
Sarcoglycan_1 [PF04790], Evalue: 0.0015, Aligned region: 684..722
Sarcoglycan_1 [PF04790], Evalue: 0.0015, Aligned region: 783..807
Protein Sequence: 835 a.a.     [Download]
>gi|384527937|ref|YP_005419169.1| Rhs element Vgr protein [Rahnella aquatilis HX2]
MSIQEYILAGSKLPIHNHYQLRLKRLESQQPGVDISVLKFSGSEAISDILRYEIEFTSAVKDIPARHIIN
YTALFLMYPDGKPWESVKPRIIPGVITQFRQCSTSADETRYVATLEHRVTRLNQGSNNAIYQNDSVISMT
ENTFLRYNMDRLDFRFALNDQYPLKKFMMQFGESEYAHIARRLADSGISYFFEYDEENNCDVMVLADHSY
AWPESVAIPFRNPAGMFDGGLESVWDMSVSRKSIPKSVTVNDDYYPAAQSDMTGTAETNPDYPALVAEDY
RWGEYYPEPGKEFSNEPGQGMWYTKRRQERYLSEQVTFEGKSNCMTLRPGMVITTPDKDWPEALDGLLIV
STNSKNVARDTAYFVTFTAVPRNTQHPYRPALLPWPTVTGTLPARISSAHPDEPYAHINADGLYRAQFGF
DRTEWQKGFESCWLRLAKPYSGDTCGFHMPLLDSTGVAIAFENGDVDRPYIACALHDSTHPDHVALPNYK
RNVIRTPSGNKIRLEDQRGKEHIKISTVHSGKSQLSLGHLVDSARKQRGEGAELRTDAYVAVRGGKGVLL
STEPKNSAQGQQLDMDAAIAQLEKALALAKTLKSTADIAKASPAETTDQELLKTDLTKLAQPGVVVYGDA
GIAHTTPKTIQQTAGKNLVATAGQDVSFSVFRRFSVAAGELFSVFANKLGIKLIAAAGKVQLQAQKDQME
LTSFEDMQITSTNGRIVLNAKKELLLMCGGAGIRIKDGTIEELAPTRITQKSPVLEYQGGDSVKQAMPSF
EEGKYAIQYRLHAEDDPTQVLKNQKFRIHRQDGSITEGATDANGESSLLHMNELENAAIELIKGL
 
Nucleotide Sequence: 2508 bp     [Download]
>gi|384527587|ref|NC_017060.1|:c380200-377693 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGAGCATTCAGGAATATATTCTTGCAGGCAGTAAATTACCGATCCACAACCATTACCAGTTGCGTCTTA
AAAGACTGGAATCCCAACAGCCCGGCGTTGATATTTCTGTGCTCAAATTCAGCGGCAGCGAGGCCATCAG
CGATATTCTGCGCTATGAGATTGAGTTTACCAGCGCGGTGAAAGACATTCCCGCCCGGCACATCATCAAC
TATACCGCCCTGTTTCTGATGTACCCCGACGGCAAGCCGTGGGAATCGGTTAAGCCACGCATTATCCCCG
GTGTGATCACCCAGTTTCGCCAGTGCAGCACTTCTGCTGATGAAACCCGTTACGTCGCCACGCTGGAGCA
CCGCGTCACCCGCTTAAATCAGGGCAGCAACAACGCGATTTACCAGAACGACAGCGTGATCAGCATGACC
GAAAACACCTTCCTGCGTTACAACATGGACCGGCTGGATTTTCGGTTTGCGCTCAATGACCAGTACCCGC
TGAAAAAATTCATGATGCAGTTTGGTGAAAGCGAATACGCCCATATTGCGCGACGCCTGGCTGATAGCGG
TATCTCCTACTTCTTCGAATATGACGAAGAGAACAACTGCGACGTGATGGTTCTGGCAGACCATTCATAC
GCCTGGCCTGAATCCGTTGCCATCCCGTTCCGCAACCCGGCGGGCATGTTTGACGGTGGCCTGGAATCAG
TCTGGGACATGTCGGTTAGCCGTAAATCAATCCCGAAATCTGTCACGGTTAACGACGATTACTACCCTGC
CGCGCAAAGTGATATGACCGGCACAGCGGAGACCAATCCCGATTATCCGGCGCTGGTCGCCGAAGATTAC
CGCTGGGGTGAGTACTATCCCGAGCCGGGCAAGGAATTCAGCAACGAGCCCGGACAGGGCATGTGGTACA
CCAAACGCCGTCAGGAACGTTACCTTAGTGAGCAAGTCACCTTTGAGGGCAAATCTAACTGTATGACGCT
GCGTCCGGGGATGGTCATCACCACGCCCGACAAAGACTGGCCGGAAGCGCTGGACGGTCTCCTGATTGTC
TCCACGAACTCTAAAAACGTCGCCCGCGATACTGCGTATTTCGTCACCTTCACCGCGGTTCCGCGTAATA
CTCAGCATCCGTACCGCCCTGCGTTGTTGCCGTGGCCGACCGTCACCGGCACGCTGCCTGCCCGTATCTC
CAGCGCGCATCCGGACGAACCTTACGCCCACATCAACGCCGACGGTTTGTACCGCGCCCAGTTTGGTTTC
GACCGCACCGAATGGCAGAAAGGCTTTGAGAGCTGCTGGCTACGTCTGGCGAAACCGTATTCCGGTGATA
CCTGCGGCTTCCATATGCCGCTGCTGGATTCCACCGGCGTGGCGATTGCCTTCGAAAATGGCGACGTTGA
CCGGCCTTATATCGCCTGTGCGCTGCATGATTCAACGCACCCGGATCATGTGGCGTTACCGAATTATAAG
CGGAACGTCATACGCACTCCTTCTGGAAATAAGATTCGACTTGAGGACCAGCGGGGCAAAGAACATATAA
AAATCAGCACGGTACATTCAGGTAAGAGCCAGCTCAGTCTGGGACACTTGGTGGACAGTGCCAGAAAGCA
ACGAGGTGAAGGCGCAGAATTGCGAACTGATGCCTATGTTGCCGTTCGCGGCGGTAAAGGCGTGCTGCTT
TCTACCGAGCCGAAGAACAGTGCTCAGGGACAGCAACTGGATATGGATGCCGCCATTGCCCAGCTTGAAA
AAGCCCTGGCTCTGGCCAAAACCCTGAAGAGTACCGCCGATATCGCTAAGGCGTCTCCGGCAGAAACCAC
CGATCAGGAGCTGCTCAAGACAGACCTCACCAAACTCGCTCAGCCAGGTGTCGTCGTCTATGGCGATGCC
GGTATTGCGCACACCACGCCGAAAACGATCCAACAAACTGCAGGTAAGAATCTGGTGGCCACCGCTGGCC
AGGATGTCAGTTTCAGCGTATTCCGTCGCTTCTCAGTTGCCGCCGGTGAACTGTTCTCCGTATTTGCGAA
CAAGTTAGGCATCAAGCTCATCGCCGCTGCAGGAAAGGTGCAGCTACAGGCGCAAAAAGACCAGATGGAG
CTGACCTCCTTCGAGGACATGCAGATCACCAGTACCAACGGCCGCATAGTGCTTAACGCCAAAAAAGAGC
TGCTGCTGATGTGTGGCGGGGCTGGGATCCGCATTAAGGATGGAACGATCGAAGAACTGGCACCGACCCG
TATTACCCAAAAATCACCGGTACTGGAGTATCAGGGTGGGGACAGCGTGAAGCAGGCGATGCCGTCATTT
GAAGAGGGCAAGTACGCCATTCAGTATCGTCTTCATGCTGAAGATGACCCGACTCAGGTGCTTAAAAATC
AGAAATTCCGTATCCACCGCCAGGATGGATCCATAACCGAAGGGGCTACGGATGCCAACGGCGAATCGTC
CTTACTCCATATGAACGAACTGGAAAATGCGGCGATTGAGCTAATTAAGGGACTATGA