SecReT6
Protein ID: 384528046
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25121
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]501490..501969 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDH8P0Q3
KEGG IDraa:Q7S_25121
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-50, Aligned region: 8..147
Protein Sequence: 159 a.a.     [Download]
>gi|384528046|ref|YP_005419278.1| type VI secretion protein [Rahnella aquatilis HX2]
MSNTQYKLSKARPPRVQITYDVEVGGAESKKELPLVMGVIGNFAKDDLPLRDRRFTHIDKDNFNNVMEGM
KPAVDMLVESTLPEKEGQMAIALEFNSMDDFSPENVAMQVEPLRKLLELREQLSDLRNRTASNDRLKEQL
VELLEGMAKDAEPAKGEVE
 
Nucleotide Sequence: 480 bp     [Download]
>gi|384527587|ref|NC_017060.1|:501490-501969 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
GTGAGTAATACACAATATAAATTGAGCAAAGCGCGTCCCCCTCGCGTTCAAATTACGTACGACGTTGAAG
TTGGCGGTGCTGAATCCAAAAAAGAATTACCTCTGGTGATGGGGGTTATCGGGAATTTTGCTAAAGATGA
TTTGCCACTGCGCGACCGTCGTTTTACGCACATTGATAAAGACAACTTTAATAATGTCATGGAAGGAATG
AAGCCGGCTGTGGACATGCTGGTGGAAAGTACGTTGCCAGAAAAAGAAGGCCAGATGGCTATTGCACTGG
AATTCAACTCTATGGATGACTTCTCTCCTGAAAACGTGGCGATGCAGGTGGAACCGTTGCGCAAACTTCT
TGAATTACGCGAGCAACTGAGTGATTTGCGCAACAGAACTGCGAGCAATGACCGTCTGAAAGAGCAACTG
GTTGAATTATTAGAGGGTATGGCGAAAGACGCAGAACCTGCCAAAGGGGAAGTAGAATGA