SecReT6
Protein ID: 384528047
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25126
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]501966..503447 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDH8P0Q4
KEGG IDraa:Q7S_25126
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.80E-181, Aligned region: 65..488
Protein Sequence: 493 a.a.     [Download]
>gi|384528047|ref|YP_005419279.1| type VI secretion protein EvpB [Rahnella aquatilis HX2]
MSDIQVMNASAQAEQSGDYLDQIIDNTQAIRRESDRNKVKSQLDNFLSEVASGAVIVSNDLVGSIEARIA
AIDELLSSQVSKIIQAPEFQRMESSWRGLHKLVQSSVTENTKVRVFNCTKKELLRDFKSASDFDQSSLFK
SIYESEYGTFGGDPYSAFVGDFEFDCMPEDVQLLEQISHVAAAAHAPFLSAANPGMFAMGSFSEMPRPRD
LGKLFETSDYARWKSFRQSDDSRYVGLTLPRVIGRLPYGAKTVSVDAFNFEEKIDENNEGASYLWVNAAY
DLAGRMVEAFEEHGWCAAIRGVEGGGLVKSLPTYNYISQTGEKVMQCPTEVAISDRREKELAELGFIPLI
YCKGTDYAAFFAVQSTNKPRKYDSELANANAKLSSQLQYIMTTSRFAHYLKSIVRDKVGSFMSKSECQNF
LQNWINQYVVGSDNVGPTIKASHPLREAVVEVVDVPGSPGSYRAVAYLKPHFQLEGLSMSLRLVAELPAS
TGA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|384527587|ref|NC_017060.1|:501966-503447 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGAGCGATATCCAGGTCATGAATGCTTCAGCTCAAGCTGAGCAGTCCGGTGATTATCTCGATCAAATTA
TCGATAATACTCAGGCCATCCGCCGGGAATCCGATCGTAATAAAGTAAAAAGCCAGTTGGATAACTTCCT
GTCGGAAGTGGCATCAGGTGCGGTCATTGTTTCCAATGATCTGGTGGGTAGCATCGAAGCACGCATTGCC
GCCATCGATGAACTGCTGTCTTCTCAAGTCAGCAAAATTATTCAGGCACCTGAATTCCAGCGTATGGAAT
CTTCCTGGCGTGGTTTGCACAAACTGGTGCAAAGCAGCGTCACGGAAAACACCAAAGTGCGTGTCTTTAA
CTGCACGAAGAAAGAGCTGCTGCGTGATTTTAAATCCGCCTCTGACTTTGATCAGTCTTCATTATTCAAA
AGCATTTATGAAAGCGAATACGGTACCTTTGGCGGTGACCCTTACTCTGCTTTTGTGGGTGATTTTGAAT
TCGACTGTATGCCGGAAGATGTGCAACTGCTGGAACAGATTTCACATGTTGCCGCCGCCGCCCACGCGCC
ATTCCTGAGTGCTGCGAACCCTGGCATGTTTGCGATGGGATCGTTCTCCGAAATGCCGCGTCCGCGTGAT
CTGGGCAAACTGTTTGAAACCTCTGACTACGCCCGCTGGAAATCCTTCCGTCAGAGTGACGACTCACGTT
ATGTCGGCTTAACGCTGCCACGTGTTATCGGCCGTCTGCCTTACGGTGCAAAAACTGTATCCGTAGACGC
GTTTAATTTCGAAGAAAAAATTGATGAAAATAATGAAGGAGCCAGCTATTTATGGGTCAACGCGGCTTAT
GATTTAGCGGGCCGTATGGTCGAGGCGTTTGAGGAACACGGCTGGTGTGCGGCGATCCGTGGTGTTGAAG
GCGGCGGTTTGGTGAAGTCACTGCCGACCTACAATTACATTTCGCAGACCGGCGAAAAGGTCATGCAATG
CCCGACAGAAGTGGCAATTTCTGACCGTCGCGAAAAAGAGTTAGCTGAGCTTGGTTTTATTCCGCTCATT
TATTGCAAAGGTACAGATTACGCGGCGTTCTTCGCTGTGCAGTCGACCAATAAACCGCGTAAATACGATT
CTGAGCTGGCGAATGCTAACGCCAAATTGTCAAGTCAGTTGCAATATATTATGACAACGTCGCGCTTTGC
TCATTATCTAAAATCCATCGTGCGCGATAAAGTGGGCAGCTTCATGTCCAAATCTGAATGCCAGAATTTC
CTGCAGAACTGGATCAACCAATATGTTGTGGGTTCAGATAATGTAGGACCAACGATTAAAGCAAGCCATC
CGTTACGTGAGGCTGTGGTCGAAGTTGTTGATGTACCAGGTTCTCCGGGCAGTTATCGCGCCGTTGCGTA
TTTAAAACCGCATTTCCAGCTTGAAGGACTCAGCATGTCGCTGCGTCTGGTAGCGGAACTTCCTGCATCG
ACGGGTGCATAA