SecReT6
Protein ID: 384528048
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25131
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]503477..503968 [+]
Producthypothetical protein
NoteTssD
UniProt IDH8P0Q5
KEGG IDraa:Q7S_25131
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.60E-21, Aligned region: 7..137
Protein Sequence: 163 a.a.     [Download]
>gi|384528048|ref|YP_005419280.1| hypothetical protein Q7S_25131 [Rahnella aquatilis HX2]
MATESLFMQIDGIKGTVSNKGYEGWIAVENMNFGVYCSAKIDNASGQVNSDGVNFDAISFSKVMDTTSTQ
LSNMVAQGSNVKQIVIVKALFQGEKLVEALKLTYKNCVLNSYNFNAYSEGDVPSENLSFVFGQMTFETNM
VEPDGKTSKQGPVGWNLVENTKL
 
Nucleotide Sequence: 492 bp     [Download]
>gi|384527587|ref|NC_017060.1|:503477-503968 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGCCACTGAATCGCTTTTCATGCAAATTGATGGTATTAAAGGCACTGTAAGTAATAAAGGTTATGAAG
GTTGGATTGCCGTTGAGAATATGAATTTCGGTGTTTACTGCTCAGCTAAAATTGATAATGCCAGCGGTCA
GGTAAACAGCGATGGCGTCAACTTTGATGCAATTTCATTTTCAAAAGTAATGGATACTACCTCTACTCAG
TTATCCAATATGGTTGCGCAAGGCAGCAATGTTAAGCAAATTGTTATTGTTAAAGCATTGTTCCAGGGTG
AGAAACTGGTTGAAGCACTCAAGCTGACCTATAAAAACTGTGTACTGAACAGCTACAACTTCAACGCTTA
TTCAGAAGGGGATGTTCCGAGTGAAAATCTGAGCTTTGTATTTGGTCAGATGACATTCGAAACTAATATG
GTTGAGCCAGACGGTAAAACCAGCAAACAAGGTCCTGTGGGCTGGAATCTGGTTGAGAACACTAAGCTGT
AA