SecReT6
Protein ID: 384528049
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25136
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]504021..504437 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDH8P0Q6
KEGG IDraa:Q7S_25136
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-09, Aligned region: 25..114
Protein Sequence: 138 a.a.     [Download]
>gi|384528049|ref|YP_005419281.1| GPW/gp25 family protein [Rahnella aquatilis HX2]
MKSLLQQLSDNNPKDQNDLIEEEDKSSTLIDEILLLLSSRPRSYRIDNIPLINESILNYGVSDVFSSDTP
RLERNVIMQSRIEMALQRFEPRLKNVCVTPGEELGSLCSFIINAETFNGEVRYRLMWDDVISQFSLRD
 
Nucleotide Sequence: 417 bp     [Download]
>gi|384527587|ref|NC_017060.1|:504021-504437 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGAAGAGCTTATTACAGCAATTATCTGACAATAACCCAAAAGATCAAAATGACCTTATTGAGGAAGAAG
ACAAAAGCAGCACACTCATTGACGAAATATTGCTGCTTTTGTCTTCACGCCCCCGAAGTTACCGCATTGA
TAATATTCCACTGATTAATGAGTCGATACTTAATTATGGAGTCAGTGACGTTTTTTCCAGTGATACGCCT
CGTCTTGAGCGCAATGTCATTATGCAATCACGTATTGAAATGGCATTACAACGCTTTGAACCAAGATTGA
AAAACGTCTGCGTGACCCCCGGTGAAGAACTGGGAAGTCTTTGTTCATTCATTATTAATGCTGAAACATT
CAATGGTGAAGTTCGCTACCGTCTAATGTGGGACGATGTCATCAGTCAATTTTCTCTGCGTGATTAA