SecReT6
Protein ID: 384528050
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25141
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]504450..506252 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDH8P0Q7
KEGG IDraa:Q7S_25141
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-165, Aligned region: 7..596
Protein Sequence: 600 a.a.     [Download]
>gi|384528050|ref|YP_005419282.1| type VI secretion protein [Rahnella aquatilis HX2]
MLAKKLISYYQNELAYLKTQGKAFARHFPKVARRLGMSEGTSEDPHIERIIESFALVTAQIQQRLDEDMP
EVTDALLTVLAPQFLRPFPSVCVVQMQPDIKVSALTASNRIDAGTALFSRPVNGQVCRFRTTYPVTLQPV
SLHNVSLHLDADDMSWSLKIQLSVWPGATLAADSLRLHLSGASRIVNILYTLLCSEVESLTVFQQGQSHT
LSPQTIRAAGFGENEGLLAGDSRVSPTHSLLQDYFYFPQKFHFIDMPLPAGMVAGSQSELSLVVKFNRCM
IARQLEKIAGAVNENLFLLNCTPAVNLFAHRAEPISPDHETAEYPVIPDIRHQDAMEVWSVDGVSAMRKL
GNETQSRPVYPLFGLDHSASDGETGLFWQCMRRETMQNDGVATSLFIAFSDRGESPLAPGCDIVSMNLTC
TNREIPAAMRNGAPEGDFESELPIAGMKIIALTRPTLPVRPPAKQATRWRLISQLSLNHMLISGPEGARV
LRESLALYNFVDNPGITRLINLILHVESGPVVTRLAPLDPRSMARGMEIRITFASEAAEEVEYFLLCRFI
DCFLALYAPVNSFTRVITCIDSPGETPRTWPVRAGRLSWI
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|384527587|ref|NC_017060.1|:504450-506252 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGTTGGCGAAAAAATTAATTTCTTATTATCAGAATGAACTCGCTTACCTCAAAACGCAGGGGAAGGCGT
TTGCCCGCCATTTCCCAAAAGTCGCCAGACGCTTAGGGATGTCAGAAGGTACGTCAGAAGATCCACATAT
TGAGCGAATTATTGAGTCCTTTGCGCTGGTCACGGCGCAGATTCAGCAACGTCTCGATGAGGATATGCCG
GAAGTGACTGATGCATTGCTGACGGTGTTGGCTCCGCAATTTTTGCGTCCTTTTCCTTCGGTTTGCGTCG
TACAAATGCAGCCAGATATCAAAGTCAGTGCGCTGACAGCCAGTAACCGCATTGACGCCGGAACAGCATT
ATTTTCCCGTCCGGTGAACGGACAGGTCTGCCGTTTTCGCACCACTTATCCGGTTACGCTTCAACCTGTC
AGTCTGCATAACGTCAGCCTGCATCTGGATGCCGATGACATGAGCTGGAGTCTGAAAATACAATTATCGG
TCTGGCCCGGTGCCACACTGGCGGCGGATTCCCTGAGGTTGCATCTCAGCGGCGCCAGTCGCATCGTCAA
CATCCTTTATACCTTGCTGTGCAGCGAAGTTGAGTCACTGACAGTTTTCCAGCAAGGGCAGAGTCATACG
CTGTCGCCGCAAACTATACGTGCCGCAGGCTTCGGTGAAAATGAAGGCTTGCTTGCGGGTGATTCACGGG
TTTCGCCCACTCACAGCCTGTTGCAGGACTATTTTTACTTCCCGCAAAAGTTTCATTTTATTGATATGCC
GTTGCCTGCTGGCATGGTGGCGGGCAGTCAAAGCGAGCTTTCACTGGTGGTGAAATTCAACCGCTGCATG
ATAGCGCGTCAGTTGGAGAAAATAGCTGGTGCGGTGAACGAAAACCTGTTTCTGCTCAACTGCACGCCTG
CTGTTAATCTTTTCGCCCATCGGGCCGAACCGATTTCACCTGATCACGAAACGGCGGAATATCCGGTTAT
CCCTGACATTCGTCACCAGGATGCGATGGAAGTCTGGTCTGTAGACGGCGTTTCGGCGATGCGCAAACTG
GGCAATGAAACACAGTCCCGGCCTGTTTATCCATTGTTTGGTTTGGACCATTCCGCCAGTGACGGTGAAA
CCGGTTTGTTCTGGCAATGTATGCGCCGCGAAACCATGCAAAATGACGGTGTCGCCACATCGTTATTTAT
CGCTTTTTCTGACCGGGGAGAAAGCCCGTTAGCGCCCGGTTGCGACATTGTCAGCATGAACCTGACCTGC
ACCAATCGTGAGATTCCCGCAGCCATGCGCAACGGCGCTCCTGAAGGCGATTTCGAATCAGAGCTGCCGA
TTGCGGGCATGAAAATTATTGCGCTGACACGCCCGACGCTGCCGGTCAGGCCACCGGCTAAGCAGGCTAC
GCGCTGGCGTTTGATTTCTCAGCTTTCGCTCAACCATATGTTGATCAGTGGGCCGGAAGGCGCCCGTGTA
CTCAGGGAATCACTGGCGCTTTACAACTTTGTCGATAATCCGGGCATTACCCGCTTGATCAACCTGATCC
TGCATGTCGAGTCTGGCCCGGTCGTTACCCGGCTGGCGCCTTTGGATCCCCGTTCCATGGCGCGGGGGAT
GGAGATCCGCATAACCTTTGCCAGCGAAGCGGCCGAAGAAGTTGAGTACTTCCTGCTGTGTCGCTTTATT
GATTGTTTCCTGGCGTTGTACGCACCGGTCAACAGTTTCACCCGTGTAATCACCTGCATTGACTCACCGG
GTGAAACTCCACGGACGTGGCCTGTGCGGGCAGGAAGGCTGTCATGGATCTAA