SecReT6
Protein ID: 384528051
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25146
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]506243..507190 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDH8P0Q8
KEGG IDraa:Q7S_25146
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-67, Aligned region: 10..296
Protein Sequence: 315 a.a.     [Download]
>gi|384528051|ref|YP_005419283.1| type VI secretion protein [Rahnella aquatilis HX2]
MDLSKILSPHNFFQQVRLMLRSLTRAQGKDSKQVLEAQLDFISPLSLDAPKGDITSVTPLDQQRWQVEVA
AQGLTGALGALPTVYTEWMIDRYYRHGDKTAKAFLDIFNHRLHSLRYLAWQKYHYYAMAEFSATRPLSQA
IRALSGVANSAPSLQQEQFADLFAHSVRSMLNVETWLKHRFSVAAKVTPFTGGWQVMDPAQCCRLGEPSH
TLAAAPMLGSVYWDRQSHFTVTLGPVPMKNAGLFLPKGKHYQNLWSHLREYVGPGLDFDIDLLIENTTNV
VTSLGCGQLGLDICLGASEGAGQHKIRLPVCREGK
 
Nucleotide Sequence: 948 bp     [Download]
>gi|384527587|ref|NC_017060.1|:506243-507190 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGATCTAAGCAAAATCCTCAGTCCGCATAACTTTTTCCAACAGGTGCGGCTGATGTTACGCAGTCTGA
CCAGAGCACAGGGAAAAGACAGCAAACAGGTGCTCGAAGCGCAACTTGATTTCATTTCACCGCTCTCGCT
GGATGCGCCGAAAGGTGACATTACGTCGGTAACTCCGCTGGATCAGCAGCGCTGGCAAGTTGAAGTGGCC
GCCCAGGGACTGACGGGGGCACTGGGCGCGTTACCCACGGTATACACCGAGTGGATGATCGACCGCTATT
ACCGCCATGGGGACAAAACTGCCAAAGCTTTTCTGGACATTTTTAACCACCGGCTACATAGCCTGCGCTA
TCTCGCCTGGCAGAAATATCACTATTACGCCATGGCAGAATTCAGTGCAACACGGCCGCTGAGTCAGGCC
ATCCGTGCGTTATCCGGCGTGGCAAACAGTGCGCCATCTCTGCAGCAGGAGCAGTTTGCTGATTTATTTG
CGCATTCAGTGCGCTCAATGCTCAACGTTGAAACCTGGTTAAAACACCGCTTTTCCGTGGCGGCGAAAGT
CACGCCTTTTACCGGCGGATGGCAGGTCATGGACCCGGCCCAGTGTTGCCGGCTGGGAGAACCGTCACAT
ACGCTGGCCGCTGCTCCCATGCTGGGCAGCGTGTACTGGGATCGGCAATCACATTTTACGGTGACACTGG
GACCGGTGCCGATGAAAAACGCCGGTCTTTTTTTGCCAAAGGGCAAGCACTACCAAAATCTGTGGTCGCA
TCTGCGTGAATACGTTGGTCCGGGTCTGGATTTTGATATTGATCTGCTGATCGAAAATACCACGAACGTC
GTTACCTCGTTGGGGTGCGGGCAACTCGGGCTGGATATTTGTCTCGGGGCCTCCGAGGGAGCAGGCCAGC
ATAAAATTCGTTTACCCGTCTGCCGGGAAGGAAAATAA