SecReT6
Protein ID: 384528052
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25151
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]507194..509083 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDH8P0Q9
KEGG IDraa:Q7S_25151
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-57, Aligned region: 31..325
Phage_base_V [PF04717], Evalue: 3.90E-23, Aligned region: 359..451
DUF2345 [PF10106], Evalue: 0.0032, Aligned region: 545..616
Gp5_C [PF06715], Evalue: 0.0045, Aligned region: 491..510
Gp5_C [PF06715], Evalue: 0.0045, Aligned region: 520..542
Gp5_C [PF06715], Evalue: 0.0045, Aligned region: 612..626
Protein Sequence: 629 a.a.     [Download]
>gi|384528052|ref|YP_005419284.1| ImpA family type VI secretion-associated protein [Rahnella aquatilis HX2]
MSKVVGQDNRFIRFVGDAADSLTLMYIEGDEQFSDTFSYQVQFRTSLITPQMGRFLGHEMACEIGRGNQK
RYVHGVLTQIKEDNNVDGISTFTGTLEPRMALLRLGRNLAVFQNITVPDLVCKLLRQQNISHIDLRLRAT
YQPREYCIQYRESDFDFISRLLEQEGIYYFFQHDAGQHTLVLADHPSSHQSGKTAELPFMPLQGRGDGVG
ILNWVASSSLAASSVMLKGFNIVQAASVEGESKAVEAEYSVPGVSYVDAHGHEKRELLQSEARLKMEQLE
ADNQQFYAEASVWWLGCGDKFLLSGHPSCRGNYRIKSVHMHASSNIDDGQPDFGYALTVLKDSLSWRPPC
LTRQPEIAGILTAIVVGPKSEEVHTDEYGRIKIQFPWDRENKHDDGSSCWVRVSQPWAGGRFGAMFLPRV
NSEVTVSFVHGNPDYPLVTGSVYNGQNKPPLSLPEEKNHAGFVSRSSLNGNVEEGHELRFDDKKGEEDLL
LTVKNDVTTRITKNVTETIGENRTTELTKGNESLTLKQGDYALDIKGNLQESLTSGNHQLNISGGGSTVK
ADKACVIESTQSIELKVGSSKITLSPSGITLSGTTIKIEGKGTAELKGAMVTVQGSGMTQIKGGVTMIG
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|384527587|ref|NC_017060.1|:507194-509083 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGTCGAAAGTAGTAGGACAAGACAACCGGTTTATCCGTTTCGTTGGCGATGCCGCTGATTCACTGACGC
TGATGTATATCGAGGGCGATGAACAATTCTCTGACACCTTCAGCTATCAGGTCCAGTTTCGCACGTCGTT
AATAACTCCGCAGATGGGGCGTTTTCTGGGGCATGAAATGGCCTGTGAGATTGGCCGTGGCAACCAAAAG
CGCTACGTGCATGGTGTGCTGACACAGATTAAAGAAGACAATAATGTCGATGGCATCAGTACCTTCACCG
GTACGCTGGAACCGCGCATGGCATTGTTGCGTCTCGGGCGTAACCTGGCGGTTTTCCAGAATATTACCGT
ACCGGATTTAGTGTGCAAGCTGCTGCGCCAGCAGAACATCAGCCACATTGATTTGCGTCTGCGTGCGACT
TATCAGCCGCGTGAATACTGCATTCAGTATCGCGAATCCGATTTTGACTTCATTAGCCGCCTTCTTGAGC
AGGAAGGGATCTATTACTTCTTCCAGCATGATGCCGGGCAACACACGCTGGTACTGGCCGATCATCCGTC
CAGCCATCAGTCTGGCAAAACGGCGGAGTTACCCTTTATGCCACTGCAGGGGCGAGGCGATGGCGTCGGT
ATCCTGAACTGGGTGGCCAGTTCTTCACTGGCGGCCTCTTCCGTGATGCTCAAAGGTTTTAACATTGTGC
AGGCAGCCAGTGTGGAGGGCGAATCGAAAGCCGTGGAAGCGGAATATTCCGTGCCGGGTGTCAGCTACGT
GGACGCGCACGGCCATGAAAAACGCGAATTACTGCAATCAGAAGCCCGGCTGAAGATGGAACAGCTTGAG
GCCGATAACCAGCAGTTTTACGCCGAAGCCAGCGTGTGGTGGCTAGGCTGTGGCGATAAATTCCTTCTGA
GCGGGCATCCTTCCTGTCGGGGAAACTACCGAATCAAGTCGGTTCATATGCATGCATCAAGCAACATTGA
TGACGGGCAGCCTGATTTTGGCTACGCGCTCACTGTGTTGAAAGACAGCCTTTCCTGGCGTCCGCCGTGC
CTCACCAGACAACCTGAAATCGCCGGTATTCTGACCGCCATCGTTGTCGGGCCAAAATCAGAAGAAGTCC
ACACGGACGAATATGGCCGCATCAAAATTCAGTTCCCGTGGGATCGCGAAAACAAACATGACGATGGCAG
TTCCTGCTGGGTGCGGGTTTCGCAGCCGTGGGCGGGTGGCCGTTTCGGCGCCATGTTCCTGCCTCGCGTC
AACAGCGAAGTTACGGTCAGCTTTGTGCATGGCAACCCTGATTATCCTCTGGTGACCGGCTCGGTATACA
ACGGGCAAAACAAACCGCCGCTGAGCCTGCCTGAGGAGAAAAATCACGCCGGATTCGTTTCACGCAGCTC
CCTCAACGGCAATGTTGAAGAAGGCCATGAGTTGCGCTTCGACGATAAAAAAGGCGAAGAAGATCTGCTG
CTGACAGTGAAAAACGACGTCACCACCCGTATTACCAAAAACGTCACTGAAACCATTGGTGAGAACCGCA
CGACCGAGTTAACCAAAGGTAATGAAAGCCTGACGCTTAAACAGGGCGATTATGCCCTGGATATTAAAGG
CAATTTGCAGGAAAGCCTGACCAGCGGTAACCATCAGCTAAACATCAGTGGTGGCGGTAGCACGGTCAAA
GCGGACAAAGCCTGCGTTATTGAATCGACCCAGTCTATCGAATTAAAAGTCGGTAGCAGCAAAATTACTC
TTTCTCCTTCCGGCATTACGCTGAGCGGCACCACGATCAAAATTGAAGGGAAGGGCACGGCAGAACTTAA
AGGTGCGATGGTCACTGTTCAGGGTAGCGGTATGACCCAGATCAAGGGCGGCGTGACGATGATTGGCTGA