SecReT6
Protein ID: 384528056
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25171
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]510984..511559 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDH8P0R3
KEGG IDraa:Q7S_25171
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.50E-20, Aligned region: 15..176
Protein Sequence: 191 a.a.     [Download]
>gi|384528056|ref|YP_005419288.1| type VI secretion lipoprotein [Rahnella aquatilis HX2]
MRGKRGLTGLILSVMLLAGCASDDGQSRQKAISEVAAPFANGAITLQLRAEPGLNSLNDMPNSCTVLLLQ
AKDKPTLDKILGNPATLKSLFAGAGSEGDVLQVDRYVMMPGQTNTVHIDRARDTRNVALVAGYYPFPVKK
HMVSALVPVESESTGWWEPVWQAHLAPVTLSVTLGSESIVSADVPVAGEKK
 
Nucleotide Sequence: 576 bp     [Download]
>gi|384527587|ref|NC_017060.1|:510984-511559 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGAGGGGGAAAAGGGGACTGACCGGGCTGATACTGAGTGTCATGCTGCTGGCAGGTTGCGCGTCAGATG
ATGGGCAAAGCCGTCAGAAGGCGATCAGTGAAGTGGCTGCGCCTTTCGCGAATGGGGCTATCACTCTGCA
ACTGCGGGCTGAGCCGGGGCTGAACAGCCTGAACGACATGCCCAACAGCTGTACAGTATTACTGCTACAA
GCCAAGGATAAACCGACGCTGGATAAAATACTGGGTAATCCCGCGACGCTGAAAAGCTTGTTTGCCGGTG
CCGGCAGCGAAGGAGACGTTTTGCAGGTGGATCGTTACGTCATGATGCCGGGACAAACCAACACGGTGCA
TATTGATCGCGCCCGAGATACCCGCAATGTGGCGCTGGTCGCAGGCTACTATCCGTTCCCGGTAAAGAAA
CACATGGTCAGCGCACTGGTGCCGGTAGAGTCTGAGAGCACTGGCTGGTGGGAGCCTGTCTGGCAGGCGC
ATTTAGCGCCGGTCACTCTTTCTGTCACCTTAGGCAGTGAAAGTATTGTCAGTGCAGATGTCCCTGTTGC
CGGAGAGAAAAAATAA