SecReT6
Protein ID: 384528057
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25176
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]511559..512953 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDH8P0R4
KEGG IDraa:Q7S_25176
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.00E-88, Aligned region: 20..461
Protein Sequence: 464 a.a.     [Download]
>gi|384528057|ref|YP_005419289.1| type VI secretion protein [Rahnella aquatilis HX2]
MYPEQQQIYWHSGLYLQPQHFQSLDLHYEWNLAQHLRLAQPYNHGLIEVSINEAALSDYVISVEQIRCIL
PGGTLLSLPGNSRVEQRNFRDLWKQRDQPLTIWLALRRFDPLHSNVTTLEKEHDRAVTRWINTSEERVMK
DVYDHAPDAAVARLCYNVRLLTDVEKDDAVDCECIPLTRLRYENERVILDPTFSPPSVTLFGSFSLGKLI
DTIYFELSARARKLEEYKRSERLVSDADRGDQVTQLLAMRSLNRVLPQLKNFCQARQVHPWQVYNVLCQL
VGDLSSFNDSCTFLGEWHDGENSLQTYNHNELLSCFESARKTLITLLNSLVLEDNTYITLENDLQGVFTG
SFDSAQSKNPETVLLLLRSASMPMENRQIKNPGGIKLASPRMIEPLIQHALPGIPVVRCPQPPRGVPNRR
DSHYFLVEQDSELWNKARQHSSISFYWPDMPEDLQVQIIFVVPS
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|384527587|ref|NC_017060.1|:511559-512953 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGTATCCAGAACAACAGCAAATTTACTGGCATTCCGGGCTTTATCTGCAGCCGCAGCACTTTCAGTCAC
TTGACCTGCATTATGAATGGAACCTCGCGCAGCATTTGCGGCTGGCGCAGCCCTATAATCACGGGCTGAT
TGAGGTGAGTATTAATGAAGCAGCACTGAGCGACTACGTGATCAGCGTTGAGCAGATCCGTTGTATTTTG
CCCGGCGGTACCTTGCTCTCACTGCCCGGCAACAGCCGTGTTGAACAACGCAACTTCCGTGACCTCTGGA
AACAGCGCGATCAGCCGCTGACCATCTGGCTGGCTTTACGTCGCTTTGATCCGCTGCACAGTAATGTCAC
CACGCTGGAAAAAGAGCATGATCGCGCCGTCACGCGCTGGATCAACACCAGCGAAGAGCGGGTGATGAAA
GATGTCTATGATCATGCGCCGGATGCTGCAGTGGCACGCCTGTGCTACAACGTCAGGTTGCTGACGGACG
TTGAAAAAGACGATGCGGTTGACTGCGAATGCATTCCACTCACCCGACTGCGTTATGAAAACGAACGGGT
GATCCTCGATCCGACATTCTCGCCACCTTCCGTGACACTTTTTGGATCATTCAGCCTCGGCAAGCTGATT
GACACTATTTATTTTGAACTGAGTGCGCGGGCCAGGAAGCTTGAAGAATACAAACGCTCAGAGCGACTGG
TCAGCGATGCCGACCGTGGCGACCAGGTGACACAGTTGTTAGCGATGCGTTCTCTCAACCGGGTGTTGCC
ACAACTGAAAAATTTCTGTCAGGCGCGCCAGGTTCATCCATGGCAAGTCTACAACGTGTTGTGCCAGCTG
GTGGGCGATCTTTCCTCATTCAATGACAGCTGCACCTTCCTTGGTGAGTGGCACGACGGTGAAAATTCAC
TGCAAACCTACAACCACAATGAATTGCTGAGTTGTTTCGAAAGCGCCCGTAAGACGCTGATTACCTTGTT
GAACAGTCTGGTGCTTGAGGACAATACGTATATCACGCTGGAAAACGATCTTCAGGGCGTGTTCACCGGA
AGCTTTGACAGCGCGCAGAGCAAAAATCCCGAAACGGTACTGCTGCTGTTACGTTCCGCCAGCATGCCGA
TGGAAAATCGTCAGATAAAAAATCCGGGTGGCATCAAACTGGCTTCACCAAGAATGATCGAACCACTGAT
CCAGCATGCTCTGCCGGGCATTCCGGTAGTTCGTTGTCCACAGCCACCGCGGGGTGTACCAAACCGCAGA
GATTCGCATTATTTCCTTGTCGAGCAGGATAGCGAATTGTGGAACAAAGCCCGGCAGCACAGCAGCATTT
CCTTCTACTGGCCAGACATGCCGGAAGATCTTCAGGTGCAAATTATATTTGTGGTGCCTTCATGA