SecReT6
Protein ID: 384528058
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25181
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]512953..513576 [+]
Producttype IV / VI secretion system, DotU
NoteTssL
UniProt IDH8P0R5
KEGG IDraa:Q7S_25181
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.10E-26, Aligned region: 2..198
Protein Sequence: 207 a.a.     [Download]
>gi|384528058|ref|YP_005419290.1| type IV / VI secretion system, DotU [Rahnella aquatilis HX2]
MSLLNCYLPLFRYVTAFFINPQEYSDYREFREKIITLLQQALLESERHHEKAECDDAYFAVVLWVDERVL
RSRAEWVKEWRSNLLQKYYFDISVGGEAFFDRLDQTDKTNTQLRMVYLFCLLMGFHGKYTSQDAQLLQQR
IEDERQCLPQAWRQWPNNALLVEQDAGGGEKNKTVVKKLRQRKGLLLALPVVVYLVILSTGLGIFFR
 
Nucleotide Sequence: 624 bp     [Download]
>gi|384527587|ref|NC_017060.1|:512953-513576 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGAGTTTGCTCAATTGTTATTTACCGCTGTTTCGCTATGTGACGGCGTTTTTTATTAATCCGCAGGAAT
ATTCTGATTACAGAGAGTTTCGCGAAAAAATTATTACTTTATTACAGCAGGCGCTGCTTGAGTCAGAACG
TCATCATGAAAAAGCAGAGTGCGATGATGCTTATTTCGCGGTGGTGCTGTGGGTAGATGAGCGGGTATTA
AGATCCCGCGCGGAGTGGGTGAAAGAATGGCGAAGCAATCTGTTGCAGAAATATTATTTTGATATTTCTG
TCGGCGGCGAGGCATTTTTCGACCGGCTGGATCAAACCGATAAAACCAATACACAACTGAGAATGGTGTA
TCTGTTCTGTCTGCTGATGGGCTTCCACGGAAAATATACCTCACAGGATGCGCAGCTTTTGCAACAGCGC
ATCGAGGATGAGCGGCAGTGCTTGCCACAAGCCTGGCGTCAGTGGCCGAACAATGCCTTGCTGGTTGAAC
AGGACGCAGGCGGCGGCGAAAAAAATAAAACGGTGGTGAAAAAACTACGCCAGCGTAAAGGGCTGTTACT
GGCACTGCCTGTTGTCGTCTATTTAGTGATTTTGTCCACCGGCTTAGGGATATTTTTCAGGTAA