SecReT6
Protein ID: 384528061
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25196
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]519657..521006 [+]
Producthypothetical protein
NoteTssA
UniProt IDH8P0R8
KEGG IDraa:Q7S_25196
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.40E-30, Aligned region: 275..284
DUF3702 [PF12486], Evalue: 1.40E-30, Aligned region: 304..441
ImpA-rel_N [PF06812], Evalue: 2.20E-07, Aligned region: 42..102
ImpA-rel_N [PF06812], Evalue: 2.20E-07, Aligned region: 138..154
ImpA-rel_N [PF06812], Evalue: 2.20E-07, Aligned region: 233..245
ImpA-rel_N [PF06812], Evalue: 2.20E-07, Aligned region: 290..310
Protein Sequence: 449 a.a.     [Download]
>gi|384528061|ref|YP_005419293.1| hypothetical protein Q7S_25196 [Rahnella aquatilis HX2]
MKNRVNLRALKINGHDPRLSKSFLLLSSELSPLNGTIPARLDWNALEERCFQLFHEYGYDLQSGMWFCLI
NLRLKSWKGLALALDLLSTAFTHNSQRCWPPVAAVQQRQQLIDWFNANVATHIYTLEYGPENSAEMRQVE
RSIGVLCTQSKNLQSRSHDSLNNLHYFLQVRCRSVPYPVHAKVTKAIREPVDKTPQVLSEKNVAALLTDI
VPDVEPVEIQLAETHHPRPLLWGLGGMAAGIAVCAVAAAFWFSSQTLSFSEKLSVPLLTLQHSERQINDA
WNKAPEADLNAQKEAVLAQAAPVLTWLSEQPSDVLLRQGEILSDHLEKAYPGNQYSAQWQRTVDEKAGDI
PALDGLVLANKHLDELEARLLNAEKKHSQYMTVSELKTAVYQIRQDLQRNGVPAETLLWQLSQQNENTDQ
SNSALLKQVSQRIEALNSIYFMYLFEKPI
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|384527587|ref|NC_017060.1|:519657-521006 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGAAAAACCGGGTGAATTTGCGCGCACTGAAAATTAACGGGCACGATCCGAGGCTCAGCAAATCCTTTC
TGTTGCTGAGCAGTGAGCTAAGCCCGCTGAATGGCACCATTCCCGCCAGACTGGACTGGAATGCGCTGGA
AGAACGGTGTTTTCAGCTGTTCCATGAATATGGCTACGACCTGCAGAGTGGCATGTGGTTTTGTCTCATC
AATCTGCGGCTTAAGAGCTGGAAAGGGCTGGCGCTGGCACTCGATCTGCTTTCGACGGCATTTACCCACA
ACAGCCAGCGCTGCTGGCCGCCGGTGGCCGCCGTTCAGCAGCGACAGCAGTTGATCGACTGGTTCAATGC
CAATGTGGCGACGCATATTTATACGCTGGAGTACGGGCCGGAAAACAGCGCGGAAATGCGACAGGTAGAA
AGAAGTATCGGCGTGCTGTGCACACAGTCCAAAAACCTGCAATCACGCAGCCATGACTCGCTGAACAATC
TGCATTATTTCCTGCAGGTTCGCTGTCGTTCCGTGCCGTATCCGGTCCACGCCAAAGTGACGAAAGCGAT
ACGTGAGCCCGTAGATAAGACTCCTCAGGTATTGAGTGAGAAAAATGTCGCTGCACTGCTGACTGACATC
GTACCTGATGTAGAACCGGTTGAAATCCAGCTTGCTGAGACACATCACCCGCGCCCGTTATTGTGGGGGC
TCGGTGGAATGGCTGCTGGCATAGCGGTTTGCGCCGTCGCTGCGGCGTTCTGGTTCTCATCGCAGACGTT
GAGTTTTAGTGAAAAGTTGAGCGTCCCGTTACTGACATTGCAACACAGTGAGCGTCAAATAAATGACGCC
TGGAACAAAGCGCCTGAAGCCGATCTGAATGCGCAAAAAGAGGCAGTGTTAGCGCAGGCGGCGCCGGTGC
TGACATGGCTGAGCGAACAACCCTCTGATGTATTGCTGCGTCAGGGTGAAATATTGTCTGATCATCTGGA
AAAAGCCTATCCGGGAAATCAGTACAGTGCTCAATGGCAGCGCACAGTAGATGAAAAGGCGGGAGATATT
CCGGCGCTGGACGGTTTAGTGCTTGCTAATAAACATCTTGATGAGCTTGAAGCCCGGTTGCTGAACGCTG
AAAAGAAACACAGCCAATATATGACCGTGTCAGAATTGAAAACAGCGGTATATCAGATACGGCAGGACCT
GCAGCGCAATGGTGTGCCCGCTGAAACCCTACTCTGGCAACTCAGTCAGCAAAATGAAAATACCGATCAG
TCTAATTCGGCATTATTAAAGCAGGTCTCACAAAGAATCGAAGCGTTAAATTCAATCTATTTTATGTATT
TATTTGAAAAGCCTATCTGA