SecReT6
Protein ID: 384541783
SecReT6 ID598
T6SS typeN/A
Gene symbol-
Locus tagSFxv_0214
StrainShigella flexneri 2002017
Repliconchromosome [GenBank: NC_017328] [Browse all T6SS(s) in this replicon]
Location [Strand]229168..230214 [-]
Productputative cytoplasmic protein
NoteTssA
UniProt IDD2AIZ1
KEGG IDsfe:SFxv_0214
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 221..246
Protein Sequence: 348 a.a.     [Download]
>gi|384541783|ref|YP_005725844.1| putative cytoplasmic protein [Shigella flexneri 2002017]
MEIFLSDPISAECPCGPDLEYDPEYLLLFTRAAPREEAQYGDFVSTPENINWAELERDAHRLLMRSKDIR
ILVVLLRCRIQQAGARGLSEALTLLETLCSTYPDAIHPQLLATEDITAEDAAVARSNALAALLDHEGVMA
DIRGITLSNNAAMRLQVRDVERSLSALRPADALAPESVRQQLADLEARGTLPLDAFRQAAETTERLQRHA
RETLNDQAPDFSRLTQLLALLPGAVQSTTPEILPQPQAEQPENATIVHTEQMQAEQIALPVHIAEEISPM
TGAEPRQIRDRNDALERLRVIRRWFEHSEPSSPTIPLLRQAERLVGKRVSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|384541581|ref|NC_017328.1|:c230214-229168 Shigella flexneri 2002017 chromosome, complete genome
ATGGAAATATTCCTGTCTGACCCAATTTCGGCGGAATGCCCCTGCGGCCCGGATCTGGAGTACGATCCGG
AATACCTGCTGCTGTTCACCCGCGCCGCACCGCGTGAAGAAGCGCAATATGGCGATTTTGTCAGTACGCC
GGAAAACATTAACTGGGCGGAGCTTGAGCGGGACGCCCATCGTCTGCTGATGCGCAGCAAAGATATCCGC
ATTCTGGTTGTCCTGCTGCGCTGCCGTATCCAGCAGGCCGGTGCCAGGGGACTGTCGGAGGCGCTCACGC
TGCTGGAAACGTTGTGCTCCACGTACCCGGACGCCATCCATCCTCAACTGCTCGCGACTGAAGATATCAC
CGCCGAAGATGCTGCGGTGGCACGCAGTAACGCGCTGGCGGCGTTGCTGGACCACGAAGGTGTAATGGCG
GATATTCGTGGCATTACACTGTCAAATAATGCTGCCATGCGCCTTCAGGTGCGGGATGTGGAGCGTTCGC
TATCTGCATTACGCCCGGCGGATGCGCTGGCACCAGAATCGGTACGCCAGCAACTGGCAGACCTGGAAGC
GCGCGGCACACTGCCGCTGGATGCCTTTCGCCAGGCAGCAGAGACCACTGAGCGGCTGCAACGCCATGCG
CGTGAAACGCTGAATGACCAGGCACCGGACTTCTCCCGTCTGACGCAACTGCTGGCCCTGTTACCGGGAG
CAGTGCAGAGCACCACGCCGGAGATCCTGCCACAACCACAGGCTGAGCAGCCGGAAAACGCCACCATCGT
TCATACTGAACAGATGCAGGCAGAGCAGATTGCGCTACCGGTGCATATCGCGGAGGAAATATCACCGATG
ACCGGCGCAGAACCCCGGCAGATCCGCGACCGAAACGACGCGCTGGAACGCCTGCGTGTCATCCGTCGCT
GGTTTGAGCACAGCGAACCGAGCAGCCCGACCATTCCTTTGCTGCGCCAGGCAGAACGCCTGGTCGGAAA
ACGCGTCTCGGAGGTAATAAATGAAATTCCAGTAGAACTGCTGGAGAAATGGGATGCGCTGGAGTAA