SecReT6
Protein ID: 384541785
SecReT6 ID598
T6SS typeN/A
Gene symbol-
Locus tagSFxv_0216
StrainShigella flexneri 2002017
Repliconchromosome [GenBank: NC_017328] [Browse all T6SS(s) in this replicon]
Location [Strand]230482..230787 [-]
ProductPeriplasmic chaperone of fimbral assembly machinery
NoteTssG
UniProt IDD2AIZ3
KEGG IDsfe:SFxv_0216
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.50E-20, Aligned region: 10..99
Protein Sequence: 101 a.a.     [Download]
>gi|384541785|ref|YP_005725846.1| Periplasmic chaperone of fimbral assembly machinery [Shigella flexneri 2002017]
MSNDFTQAQAPPWRYGFLNLMRRVDVQLCTVPAGNTWQPRMEKFRLGQTPALTFAPREIASVGWQEGRLH
ISLYSLVLWGPNGPLPLHYTELARNRTESRR
 
Nucleotide Sequence: 306 bp     [Download]
>gi|384541581|ref|NC_017328.1|:c230787-230482 Shigella flexneri 2002017 chromosome, complete genome
ATGAGCAACGATTTCACTCAGGCGCAGGCCCCCCCCTGGCGTTACGGTTTTCTGAACCTGATGCGCCGCG
TGGATGTGCAGTTGTGTACCGTTCCGGCGGGCAACACCTGGCAACCACGGATGGAAAAATTTCGCCTCGG
ACAAACGCCCGCGCTGACCTTTGCGCCACGAGAAATCGCCAGTGTGGGCTGGCAGGAAGGGCGCCTGCAC
ATCAGTCTGTACAGCCTCGTGCTGTGGGGGCCGAACGGTCCACTGCCGCTGCACTACACCGAACTGGCGC
GTAACCGGACTGAAAGCCGACGCTGA