SecReT6
Protein ID: 384541786
SecReT6 ID598
T6SS typeN/A
Gene symbol-
Locus tagSFxv_0217
StrainShigella flexneri 2002017
Repliconchromosome [GenBank: NC_017328] [Browse all T6SS(s) in this replicon]
Location [Strand]230784..232667 [-]
ProductOuter membrane usher protein
NoteTssF
UniProt IDD2AIZ4
KEGG IDsfe:SFxv_0217
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-211, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|384541786|ref|YP_005725847.1| Outer membrane usher protein [Shigella flexneri 2002017]
MDPRLLEYYNRELSYLRETGAEFAARHPKVAARLGMQGTDIADPYVERMVEAFSFLTARTQLKIDAEFPR
FTQRLLEVVSPNYVTPTPSMSVAQLHPDTEEGDLAKGFTVPRDTAFFSAIPEGESTACQFRSSQDVTLWP
LAIEEARLTAAPPDMPALHRYLPANIHVAGALRITLRTFGELTFSQLAGLDRLPFYLCGEERTASHLLEL
LHTSAIAPLAGIPGHFDGALDVNLQQPVMYEGLEPDQGLLPLAWNVFHGHNLLHEYFACPERFYFFTPTG
LSAGLQKIDGGVAEIVILLNRLPPDWLIHQTNAAQFSLFCTPVINLFPRVTARIDVTHSTTEQHLVVDRT
HPLDYEVFSVQEVEGLETDTTRKMAFRPLYHTRNNDEGNHGRYFSLRREPRRLSENARRYGTRTPYTGSE
VFLSLVDQYEAPYPENLRHITITAMVTNRDLPCLIARNGRDDLTVDAAIPVAGVGLIRPPRSPQPPMAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGKIMTWPVRAGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|384541581|ref|NC_017328.1|:c232667-230784 Shigella flexneri 2002017 chromosome, complete genome
ATGGATCCACGGCTACTGGAATACTACAACCGCGAACTGAGCTATCTGCGGGAAACGGGAGCCGAATTTG
CCGCCCGTCATCCCAAAGTCGCCGCCCGGCTGGGCATGCAGGGAACGGATATTGCCGATCCGTATGTAGA
GCGAATGGTCGAGGCCTTCAGCTTCCTGACCGCCCGCACGCAGCTAAAAATTGACGCTGAATTCCCCCGT
TTCACCCAGCGCCTGCTGGAAGTGGTCAGCCCCAATTACGTCACACCCACGCCCTCAATGAGCGTGGCGC
AGTTGCATCCCGATACGGAAGAAGGCGATCTGGCGAAAGGATTTACCGTCCCGCGCGACACAGCCTTTTT
CTCCGCCATTCCGGAAGGCGAAAGCACTGCCTGCCAGTTTCGCAGCAGCCAGGATGTAACGCTGTGGCCG
CTCGCCATCGAAGAGGCGCGACTGACCGCCGCGCCACCGGATATGCCTGCCCTGCACCGCTACCTGCCGG
CCAACATTCACGTCGCCGGGGCGCTGCGTATTACCCTGCGCACCTTTGGTGAACTAACGTTCAGTCAGCT
TGCCGGACTGGACAGGCTGCCGTTTTATCTCTGCGGCGAGGAGCGTACGGCCTCACACCTGTTAGAACTT
CTACATACCAGCGCCATCGCGCCCCTGGCTGGCATTCCGGGGCATTTTGACGGCGCGCTGGATGTGAATC
TGCAACAGCCCGTTATGTACGAAGGCCTGGAGCCGGATCAGGGGCTGCTGCCGCTGGCGTGGAACGTGTT
TCACGGTCATAACCTGCTGCATGAATATTTTGCCTGTCCGGAACGCTTCTATTTTTTCACCCCGACAGGC
CTGTCTGCCGGATTACAGAAAATTGACGGTGGCGTGGCGGAGATTGTTATCCTGCTGAACCGCCTGCCGC
CGGACTGGCTGATCCACCAGACAAATGCGGCACAGTTCAGCCTGTTCTGTACCCCGGTTATCAACCTGTT
TCCCCGCGTCACCGCCCGGATCGATGTCACGCACAGCACGACGGAACAGCATCTGGTGGTGGACAGAACC
CATCCGCTGGATTATGAGGTGTTCTCGGTCCAGGAAGTGGAAGGGCTGGAAACCGACACCACACGGAAGA
TGGCCTTTCGCCCGCTCTACCACACCCGCAATAATGATGAAGGCAATCACGGACGTTATTTTTCCCTGCG
CCGGGAGCCCCGCCGCTTATCAGAAAACGCCCGCCGTTACGGCACCCGTACCCCCTATACGGGCTCGGAA
GTGTTCCTGTCGCTGGTTGACCAGTATGAAGCGCCGTACCCGGAAAATCTGCGCCACATCACCATCACGG
CCATGGTCACTAACCGCGATCTGCCCTGTCTTATTGCCCGCAATGGCCGGGACGATCTAACCGTGGATGC
AGCCATCCCGGTGGCGGGCGTAGGGCTTATCCGCCCGCCACGCTCGCCGCAGCCCCCGATGGCTGAACGT
GAGATGGCATGGCGGTTGATCCGCCAGTTATCTTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGTA
CCGGCGGCCAGGCGTTGCGAGATCTGCTGAACCTGTTTATTCCTGCTCATGACAGTCCGCAATCGCGCCA
GGTGCGCAGCCTGATTGGTTGTAAAACGACCCCGGTCACCCGCCGTCTGCCCGGTTCCGGACTACTGGTC
TATGGGCGTGGCGTCAGTTGTGAACTGACGGTGGATGAAGAAGGTTTTTCCGGCATCAGTCCGTATCTGT
TCGGCCTGGTGCTGGAACACTATATCGCCCGCCATGTTTCCATTAATACCTTCTCGCAGATGACGCTGCA
CAGCATGCAGCGCGGCAAAATTATGACCTGGCCTGTCAGGGCGGGACAGCGGGGAAGCGTATGA