SecReT6
Protein ID: 384541788
SecReT6 ID598
T6SS typeN/A
Gene symbol-
Locus tagSFxv_0219
StrainShigella flexneri 2002017
Repliconchromosome [GenBank: NC_017328] [Browse all T6SS(s) in this replicon]
Location [Strand]233372..234004 [-]
ProductSciE protein
NoteTagJ
UniProt IDD2AIZ6
KEGG IDsfe:SFxv_0219
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.40E-22, Aligned region: 145..208
Protein Sequence: 210 a.a.     [Download]
>gi|384541788|ref|YP_005725849.1| SciE protein [Shigella flexneri 2002017]
MTNNNELPITLSALLRDYSVVEGIQMAEQQVRMHPAQASRRHSLFQLLCVAGDWSRALQQIQLCARMDAN
YTREAQVFGELIRCEIYRHACFQGEQRPGVILPPPAWMEDLLTALACNARGEAQEADAHRSRALEAITDT
SGQWNGGAFDWISDSDSRTGPVLELIAGGAYIWLPFSQICSLKSPRPAHLIDLIWKPVNVTLNNGDTHSA
 
Nucleotide Sequence: 633 bp     [Download]
>gi|384541581|ref|NC_017328.1|:c234004-233372 Shigella flexneri 2002017 chromosome, complete genome
ATGACAAACAATAACGAGCTACCGATTACCTTGTCGGCGCTGCTGCGGGATTATTCCGTGGTGGAGGGCA
TTCAGATGGCAGAGCAACAGGTCAGGATGCACCCAGCGCAGGCCTCCCGCCGCCACAGCCTGTTTCAGTT
ATTGTGCGTGGCAGGCGACTGGTCGCGGGCACTGCAACAGATCCAGCTATGCGCCCGGATGGACGCAAAT
TATACTCGCGAAGCGCAGGTATTTGGCGAGCTGATCCGCTGTGAGATATACCGCCACGCCTGCTTTCAGG
GCGAACAGCGGCCCGGTGTTATTCTCCCGCCGCCCGCCTGGATGGAGGATCTGCTGACCGCCCTCGCCTG
TAACGCCCGTGGTGAAGCGCAGGAAGCTGATGCTCACCGCAGCCGCGCGCTTGAGGCCATAACAGACACT
TCCGGGCAGTGGAATGGCGGCGCATTTGACTGGATTAGCGACAGCGACTCCCGTACCGGTCCGGTACTCG
AACTGATCGCGGGCGGAGCATATATCTGGCTGCCGTTTTCACAAATCTGTTCGCTGAAATCGCCGCGGCC
TGCGCATCTGATCGATTTGATCTGGAAACCCGTCAACGTCACCCTGAACAATGGCGATACACACAGTGCC
TAG