SecReT6
Protein ID: 385237020
SecReT6 ID599
T6SS typei4b
Gene symbol-
Locus tagABTW07_1469
StrainAcinetobacter baumannii TCDC-AB0715
Repliconchromosome [GenBank: NC_017387] [Browse all T6SS(s) in this replicon]
Location [Strand]1580899..1582380 [+]
Producthypothetical protein
NoteTssC
UniProt IDF0QL79
KEGG IDabd:ABTW07_1469
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.60E-192, Aligned region: 65..489
Protein Sequence: 493 a.a.     [Download]
>gi|385237020|ref|YP_005798359.1| hypothetical protein ABTW07_1469 [Acinetobacter baumannii TCDC-AB0715]
MNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIA
EIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLF
KKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTDIDRPR
DVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAA
YAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPL
VHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLVTELPQ
SSN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|385235550|ref|NC_017387.1|:1580899-1582380 Acinetobacter baumannii TCDC-AB0715 chromosome, complete genome
ATGAATAATACTCAATCAGCAGCAATGCCACTTGTTGAAAATGAAGAAGTTAATCTTTTAGATTCGATTG
TTGAACAAAGCCGTATTGCACGAAATGAAGAAGAACATTCTCGTGCTAAAAGCTTAATTGGTGAGCTTGC
TAAAGAAGTAATGGCAGGGACCATTACTGTTTCTGAAAATATGACTTTATCAATTGATAAGCGTATTGCA
GAAATTGATGCTCTGATTTCAAAGCAGTTAAGTCAGATCATGCACAATGAACAATTCCAAAAAATTGAGT
CAACTTGGCGTGGTCTTTATTACTTTTGTCAGGAAACGCCTTCAAATCCGCTCATTAAAATTCGTATGCT
TAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACTTTGATCAAAGCACTTTGTTT
AAGAAAATCTACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCAGCATTAATTGGTGATTTTG
AGTTTGATCGTACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTGCAGCGGCAGCACATGC
ACCATTTATTTCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGATATTGATCGTCCTAGA
GATGTTTCAAAAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTGATAGTGAAGACTCAC
GTTATGTTGCATTGACTTTGCCTCATGTCTTGGGTCGTCTCCCATATCATCCAAAAGAAGGTACTGCGAC
AGAAGGCTTTAATTTTATTGAAGATGTTTCTGGTGAAAACCACAATGAATATTTGTGGATGAATGCAGCT
TATGCTTTTGGTACTCGCTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTGCTATTCGCGGTGTTG
AAGGTGGTGGTTTAGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAAGATGGCGAAGTGGTATTCAA
GTGTCCAACTGAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGATCTAGGCTTCATTCCGTTA
GTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAAAACCTAAAAAATATG
ACAATGATACAGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCATGGCTGTTTCACGTAT
TGCACATTACTTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTGCTTCTGCTGGAAATGTTGAAGCA
TTCTTAAATGAGTGGTTGTCACAGTATGTCTTACTTGACGATGGTGCTTCTCAAGAAGCAAAAGCTCAAT
ACCCGTTACGTGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGT
TTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTCACTGAGTTACCTCAG
TCCTCAAATTAA