SecReT6
Protein ID: 385237024
SecReT6 ID599
T6SS typei4b
Gene symbol-
Locus tagABTW07_1473
StrainAcinetobacter baumannii TCDC-AB0715
Repliconchromosome [GenBank: NC_017387] [Browse all T6SS(s) in this replicon]
Location [Strand]1585281..1586279 [+]
Producthypothetical protein
NoteTssG
UniProt IDF0QL83
KEGG IDabd:ABTW07_1473
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-63, Aligned region: 18..312
Protein Sequence: 332 a.a.     [Download]
>gi|385237024|ref|YP_005798363.1| hypothetical protein ABTW07_1473 [Acinetobacter baumannii TCDC-AB0715]
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
GDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDETEIQPVRLTQGQESGLGQGAFLMSRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|385235550|ref|NC_017387.1|:1585281-1586279 Acinetobacter baumannii TCDC-AB0715 chromosome, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACGGCTGAGTTGTTTCAACGCCCTAAGTCTTTTG
AGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATGACGCAGCTTTATCATGGTCTGACCA
TTTTAAATTTGAGACCTCATTTAACTTAAACTTTCCAGCCACTGAAATTGAAAGTTTAGAGTTAGTAGAT
GAACGTGTTCATTTAACAAACCTGATCGTTGGTCTGACTGGTATACAAGGTGCATTACCTTATACATATA
CAAATAAAATTAAGCAGGCTCCAAGGCAACAACGCGCTGAAACGAAAGAGTTTTTAAGCTTATTTAATCA
TAAGCTGACCAGTCAGTATGTAGAGTCAAGTATTACTTATCACTTGCCTGTGCGCTATGAAATTGAAAAT
AAAAATGATTATTTGGATATTCTCCATGCATTGAATGGTTATGTTCGCTCACAACATCAGCAACAAGACT
TGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAGGGGCAAAATAATACGGTTCATGCTTTAAAGAC
GATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCG
GGTGATCAGCTAACCACTTTAGGCGGAAGTCAACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGCTTAAGCGTCAGCAATATTTAAAATT
TTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGAAACCTGGTGCAGTCCAACTTTATCG
ATAGATTTAAGATTGATATTGGATGAGACTGAAATACAACCTGTTCGCTTAACTCAAGGCCAAGAAAGTG
GTTTAGGGCAAGGCGCTTTTTTAATGTCTCGTAAGCCTAATACACATAACGATGAAACATGTTATAGCCT
TATTGGAGAGCAAATATGA