SecReT6
Protein ID: 385237028
SecReT6 ID599
T6SS typei4b
Gene symbol-
Locus tagABTW07_1477
StrainAcinetobacter baumannii TCDC-AB0715
Repliconchromosome [GenBank: NC_017387] [Browse all T6SS(s) in this replicon]
Location [Strand]1592543..1593310 [+]
Productouter membrane protein
NoteTagL
UniProt IDF0QL87, F0QL87
KEGG IDabd:ABTW07_1477
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 21..44
OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 154..248
BON [PF04972], Evalue: 0.0046, Aligned region: 31..66
Protein Sequence: 255 a.a.     [Download]
>gi|385237028|ref|YP_005798367.1| outer membrane protein [Acinetobacter baumannii TCDC-AB0715]
MNQKYQIKLSQLIKGCFIYAIANYALAQPIVVEGVVPNEASKQAILMKMQSVYGADQVVDKIQVRPVAAP
NGWSDSVTRVITPDLKKVSQGKLSVNGTRFELTGKMLNPTEIQPTIQSFQSLVQPPYQLFSQLSVNQAEQ
KIIDDALKNRIIEFESGSAVLTEAGQKILDEMAVALNKVGGKKVKIVGHTDSSGDATKNLKLSQDRALAV
KNYLISKNIPADHLSTEGLGSSKPVADNTSAEGRKKNRRIEFTVL
 
Nucleotide Sequence: 768 bp     [Download]
>gi|385235550|ref|NC_017387.1|:1592543-1593310 Acinetobacter baumannii TCDC-AB0715 chromosome, complete genome
ATGAATCAAAAATATCAAATTAAACTTTCACAACTTATAAAAGGCTGTTTTATATATGCAATTGCGAATT
ATGCTTTAGCACAGCCTATAGTTGTAGAAGGTGTAGTGCCAAATGAAGCAAGTAAACAGGCTATTTTAAT
GAAAATGCAGTCTGTTTATGGTGCAGATCAGGTTGTCGATAAAATACAAGTTCGACCAGTTGCCGCTCCA
AATGGATGGAGTGACTCTGTCACACGAGTGATTACACCTGATCTTAAAAAAGTTTCTCAGGGTAAGTTAA
GTGTTAATGGAACCCGATTTGAACTGACCGGGAAAATGCTAAATCCGACAGAAATACAGCCAACCATTCA
GTCTTTTCAGAGTTTGGTACAGCCTCCATATCAATTATTTTCCCAGCTTTCTGTAAATCAGGCTGAGCAG
AAGATTATTGATGATGCTTTAAAAAATCGAATTATTGAATTTGAATCTGGTAGTGCAGTATTAACTGAAG
CTGGGCAAAAAATTCTTGATGAAATGGCTGTGGCTTTAAATAAAGTGGGCGGGAAAAAAGTCAAAATTGT
GGGGCATACCGATAGTTCTGGTGATGCGACCAAAAACTTAAAACTCAGCCAAGATCGAGCTTTAGCAGTT
AAAAATTATTTAATTAGTAAGAATATTCCTGCTGATCATTTATCTACCGAAGGTTTAGGTTCATCTAAGC
CTGTAGCGGACAATACTTCTGCGGAAGGTAGGAAGAAAAACCGCCGAATTGAGTTCACCGTTTTATAG