SecReT6
Protein ID: 385237029
SecReT6 ID599
T6SS typei4b
Gene symbol-
Locus tagABTW07_1478
StrainAcinetobacter baumannii TCDC-AB0715
Repliconchromosome [GenBank: NC_017387] [Browse all T6SS(s) in this replicon]
Location [Strand]1593327..1593590 [+]
Producthypothetical protein
NotePAAR
UniProt IDF0QL88
KEGG IDabd:ABTW07_1478
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-21, Aligned region: 7..79
Protein Sequence: 87 a.a.     [Download]
>gi|385237029|ref|YP_005798368.1| hypothetical protein ABTW07_1478 [Acinetobacter baumannii TCDC-AB0715]
MASPYITIGCPTTGGGQVISGNSAFLIEGIAIACVGDKATCPAHKTVSTIVSGDPNMQVMGKAAARVNDS
LSCGCKLLPKQSLVNQG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|385235550|ref|NC_017387.1|:1593327-1593590 Acinetobacter baumannii TCDC-AB0715 chromosome, complete genome
ATGGCTAGCCCTTACATTACGATTGGATGCCCAACGACAGGTGGAGGGCAAGTCATTTCTGGTAATAGTG
CATTTTTAATTGAGGGAATCGCAATTGCATGTGTAGGTGATAAAGCAACTTGTCCGGCGCATAAAACGGT
TTCTACGATTGTTTCCGGTGACCCAAATATGCAAGTGATGGGAAAAGCAGCAGCAAGAGTAAATGATTCA
TTATCGTGTGGCTGTAAATTATTACCGAAACAAAGTTTGGTTAATCAAGGGTAG