SecReT6
Protein ID: 385237031
SecReT6 ID599
T6SS typei4b
Gene symbol-
Locus tagABTW07_1480
StrainAcinetobacter baumannii TCDC-AB0715
Repliconchromosome [GenBank: NC_017387] [Browse all T6SS(s) in this replicon]
Location [Strand]1596515..1597609 [+]
Producthypothetical protein
NoteTssA
UniProt IDF0QL90
KEGG IDabd:ABTW07_1480
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-20, Aligned region: 55..114
Protein Sequence: 364 a.a.     [Download]
>gi|385237031|ref|YP_005798370.1| hypothetical protein ABTW07_1480 [Acinetobacter baumannii TCDC-AB0715]
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEK
TKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKK
VPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFNSVLTEW
NVLKQTLDHLMGLDSPSFAAIDSAFETIHSTLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVS
DQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQM
VQEMLGVQPKNEYE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|385235550|ref|NC_017387.1|:1596515-1597609 Acinetobacter baumannii TCDC-AB0715 chromosome, complete genome
ATGAGTATTGATATTTCTGAACTACTTAAACCCATTAATGACAGCTTGCTTTGTGGTGAGGATTATTCAT
TTTCTAATGAATTTCACGAGATAAAGAAAGCCAGAACACAGGATGATCTATTATTAGATCAGGGGGATTG
GGTTGCTGAACGGAAGCAGGCAGATTGGGACTTTGTTGCGAAGAGTGTAAGCACTTTGCTCATTGAAAAA
ACCAAAGATATCCGTCTATTAACTTGGGTAATAGAAGCCTGGACTCATCTAAATGGTTTTGAAGGCATGG
TAAAGGGAATCACTTTAACTCATACCATGCTGAACCAATATTGGCAGGATATTCATCCGATTATTGAAGA
TGATGATTTGGATCAGCGTATTGGTTTATTACAAGGTCTTATTAATCAGTTGCCAATGCTGTTGAAGAAA
GTACCTTTAACCAATACAGCTCCTTATTATAACTTGCTTGATTACGATAATTTTCTATATCACGAAAATA
TACGCCGTAAGCAAACAGAAGAGTACGAGAGTCAGTCAGGTCCATCTGAATTAGAACAATTTGATCAAGC
GATCTTTAATACCTCTAAAACCTTTCAATACTCAAATTATCAAGAGTTTAATTCGGTTTTAACGGAGTGG
AATGTTTTAAAACAGACACTCGACCATTTAATGGGATTAGATTCACCGAGTTTTGCTGCAATTGATTCTG
CATTTGAAACAATACACAGCACTTTACGTAAAATTTACAAAGCAGAGGCTTTTGGTACTGGGCTTGCGCC
GAGCCAAGAACAGGCCGCTGTCATCACGACACCGTCTATGGAAAATCAAGTGCCTGTACAAATCGTATCA
GACCAGCCTATGTTTCAGCCACAAGCACAAACTCACTTGGCCAATCGCGAGCAAGCAATGAAAGTGCTGC
AAGAAATAGCTGATTATTTTCAAGCAAATGAGCCACATAGTCCTGTGAGCTATATGCTCCAAAAGACCAT
TAAATGGAGCCAAATGCCGCTGCATGAATGGTTAGCACAAGTGATTAAAGATGAGCATCCATTGCAAATG
GTTCAGGAAATGTTAGGTGTTCAACCTAAAAATGAATATGAATAA