SecReT6
Protein ID: 385237032
SecReT6 ID599
T6SS typei4b
Gene symbol-
Locus tagABTW07_1481
StrainAcinetobacter baumannii TCDC-AB0715
Repliconchromosome [GenBank: NC_017387] [Browse all T6SS(s) in this replicon]
Location [Strand]1597626..1598990 [+]
Producthypothetical protein
NoteTssK
UniProt IDF0QL91
KEGG IDabd:ABTW07_1481
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-125, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|385237032|ref|YP_005798371.1| hypothetical protein ABTW07_1481 [Acinetobacter baumannii TCDC-AB0715]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAG
SLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSVMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIELH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|385235550|ref|NC_017387.1|:1597626-1598990 Acinetobacter baumannii TCDC-AB0715 chromosome, complete genome
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGTGAAGGTTTATTTTTAAGACCTCAACATTTCCAGATTCAAG
ATACCTATCATGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTTCCATTTTCCTATGGCGTTCAAAA
ACTTAGTTTTGATGAAGCACAGTTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAA
GATGGTGAAATATATCAAGCGCCTGCTTATGACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATT
TACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATTACAAGCCAATAAACAAAATTTAATCGATCA
AAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCATGATCTGTTCACAAACGCGACA
GAGGCTGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGTAATCCTGATC
ATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTTGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACCTTGGTTTCAAATTTAAAAAGA
ACCTTGAATGTTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCT
GAGCCATTTCTTGCAATATCCGCAAATTCATCCGGAACGATTATTCTTTGAATTGCTACGTTTAGCAGGT
TCATTATTAACCTTCTCGACAGCTTATGAAGTTGATCAGTTACCTGCATATAAACATCATAATTTGCAAG
AGAGTTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATTATTTCGAGTCGTTACATCAG
TATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGATTACTCGAGAT
ACCAGACTTTATATTGCTGTATCAAGTAGCGTGATGCAGACCCATGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACA
CCACTTAATCCAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACTGCAT
CATGAACTCTATCAACGTATGTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATA
TCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA