SecReT6
Protein ID: 385333203
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3462
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3643820..3645943 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDE4PFF5
KEGG IDmad:HP15_3462
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.80E-66, Aligned region: 44..346
Phage_base_V [PF04717], Evalue: 2.10E-23, Aligned region: 221..241
Phage_base_V [PF04717], Evalue: 2.10E-23, Aligned region: 385..478
DUF2345 [PF10106], Evalue: 0.0021, Aligned region: 512..628
Protein Sequence: 707 a.a.     [Download]
>gi|385333203|ref|YP_005887154.1| ImpA family type VI secretion-associated protein [Marinobacter adhaerens HP15]
MVRKPGLYFSSGTEDMPQASGLQFTATIGEFSSDHFSVVGFALTERLSELLHGRLDLASTDSSVGASSVL
EQPIDLVIWRDGTPLRCFTGVVSEFARGESGHRRTRYQLVFQPPLWRLALMHNSRIFQNRGTDEIVRTLL
EERGIVDTVFDLERRPEEREYCVQHRESDLAFVERLAAEEGWHYRYQHGSLDGQEPPALVFADHHRDSPR
LEAVPYNGKAGGSTRTPCVFRFAYRKRVRPASVAMKDYTFKNPAYALMHEQSGDKLVHREDYQHYDYPGR
FKQDASGRPFTEARLAALRSDASTAFGESNRPEFAPGARVPLTDHDNEAMNRDWLLTAITHTGSQPQAVE
EEGGSEPTRYGNHFTAIPADRSWRPVCEHKPLMDGPQMAMVTGPEGEEIHCDQYGRVKVRFPWDRYALND
QHSSAWLRVSQGWAGGQYGFTALPRIGHEVIVSFLDGDPDQPIITGRTWHATNTPPYSLPEHKTRTTLKT
KTHKGEGSNELRFEDEAGGEQIYVHAQKDLALITENNRTEVIRNDCHLTVGNDRKAHIKGSGHATVNGEK
REKNSKDRSFNVTGTLHLKAGTAWLTDSGTELHIKAGQKAVIEAGAEITLNAGGSFVKIDPSGVAMAGAT
IKLNAGGAPGKGSGQRVQVPDMPGLVEKNGEAVAPVALPETQQRPMAKSDQMRAIKNAANQGKGICQVCS
SESQGAI
 
Nucleotide Sequence: 2124 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3645943-3643820 Marinobacter adhaerens HP15 chromosome, complete genome
ATGGTGCGAAAGCCCGGACTTTATTTTTCTTCAGGGACCGAAGACATGCCCCAGGCAAGCGGACTGCAAT
TCACCGCCACCATTGGCGAATTCTCCTCTGATCACTTTTCCGTTGTTGGCTTCGCGCTGACAGAGCGACT
GTCGGAGCTGTTGCATGGACGTCTTGACCTCGCCAGCACTGACTCGTCTGTTGGCGCCTCCAGCGTTCTG
GAGCAACCGATAGATCTCGTGATCTGGCGAGACGGGACCCCGCTGCGCTGTTTTACCGGCGTCGTCAGCG
AATTTGCCCGCGGCGAATCCGGCCATCGGCGTACCCGCTACCAACTGGTTTTCCAACCACCGCTCTGGCG
CCTGGCGCTGATGCACAACAGCCGTATTTTCCAGAACCGCGGCACGGATGAGATTGTGCGTACCCTGCTG
GAGGAGCGGGGGATTGTCGATACCGTCTTCGACCTTGAACGCCGCCCCGAGGAGCGGGAATACTGCGTCC
AGCATCGGGAAAGTGATCTGGCCTTTGTTGAACGTCTGGCTGCCGAAGAAGGCTGGCACTACCGCTACCA
GCACGGCAGCCTCGATGGTCAGGAGCCACCGGCCCTGGTTTTTGCCGATCATCATCGCGATTCGCCACGG
CTCGAAGCCGTCCCTTACAACGGCAAAGCAGGGGGCAGCACCCGAACGCCCTGTGTGTTCCGGTTCGCGT
ACCGGAAACGGGTGCGCCCTGCTTCGGTCGCCATGAAGGATTACACCTTCAAAAACCCGGCCTATGCCCT
GATGCATGAGCAGTCTGGCGATAAGCTCGTCCACCGGGAGGATTACCAGCACTACGACTACCCCGGCCGA
TTCAAACAGGATGCCAGTGGTCGGCCGTTCACTGAAGCCAGGCTTGCGGCGCTGCGCAGCGATGCCAGCA
CAGCCTTTGGCGAGAGCAATCGCCCGGAGTTTGCACCTGGGGCCAGGGTGCCCCTGACCGACCACGACAA
CGAAGCCATGAATCGCGACTGGCTGCTCACGGCGATCACCCACACCGGCTCACAACCCCAGGCCGTGGAA
GAAGAGGGTGGCAGCGAACCGACACGCTACGGCAACCACTTTACCGCCATCCCCGCAGACCGTAGCTGGC
GGCCCGTGTGTGAGCACAAACCATTGATGGACGGACCCCAGATGGCCATGGTGACCGGCCCGGAAGGCGA
AGAAATTCATTGCGACCAATACGGCCGGGTGAAAGTGCGCTTTCCCTGGGATCGCTATGCGTTAAATGAT
CAACACAGCAGTGCCTGGCTCCGAGTCAGCCAGGGTTGGGCCGGCGGCCAGTATGGTTTCACCGCACTGC
CGAGGATCGGCCATGAAGTGATCGTTTCCTTCCTGGACGGCGACCCGGACCAGCCGATCATCACCGGCCG
GACCTGGCACGCCACCAACACACCGCCGTATTCGCTGCCGGAACACAAAACCCGCACCACCCTGAAAACC
AAAACCCACAAGGGCGAGGGCAGTAACGAGCTTCGGTTTGAAGACGAAGCCGGCGGAGAACAGATCTACG
TTCACGCCCAGAAAGACCTAGCTCTGATCACGGAGAACAACCGCACTGAAGTCATCAGGAACGATTGCCA
CCTGACCGTGGGCAACGACCGCAAGGCCCACATAAAAGGCAGTGGCCACGCCACGGTGAACGGTGAAAAA
CGGGAGAAAAACAGCAAAGACCGCAGTTTCAACGTCACTGGTACGTTGCACCTGAAAGCCGGCACGGCCT
GGCTAACCGACTCTGGCACCGAATTGCATATCAAGGCCGGCCAGAAAGCCGTTATTGAAGCCGGTGCGGA
AATCACCCTCAATGCCGGTGGCAGCTTCGTGAAGATCGACCCCAGCGGTGTGGCTATGGCTGGGGCGACG
ATCAAACTTAATGCTGGAGGGGCCCCGGGTAAGGGGAGTGGGCAGAGGGTGCAGGTGCCGGATATGCCGG
GGTTGGTGGAGAAGAATGGGGAGGCTGTTGCGCCGGTGGCCCTGCCGGAGACACAGCAAAGACCGATGGC
CAAGTCCGACCAGATGCGCGCCATCAAGAATGCCGCGAATCAGGGTAAGGGAATTTGCCAGGTCTGCTCA
TCAGAATCACAAGGTGCGATCTGA