SecReT6
Protein ID: 385333205
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3464
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3649641..3651095 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDE4PFF7
KEGG IDmad:HP15_3464
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-17, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 3.20E-17, Aligned region: 155..167
ImpA-rel_N [PF06812], Evalue: 3.20E-17, Aligned region: 412..423
Protein Sequence: 484 a.a.     [Download]
>gi|385333205|ref|YP_005887156.1| ImpA domain-containing protein [Marinobacter adhaerens HP15]
MIQDSNMQIIEQHPYVEQVVSPLPGDSVVGEALGDDATLEFLENEIMKVGSLAHTDIDWNRVESDALTIL
SDRSKDLKVLGFLLIALQRGGDGERFALSLYLLHRVLDEWWEQAWPYPGDKGKRARKMMFTQMLQRASKG
VDALAFDGSVGDGRAFCLELLARLMDQAAGRELPEESLQDLKRAVEKLPRVNDATAAPEPRSPAGSVSQD
SGTETPEQKPASSKPSLGALTLDPGDERATRQSLLKVADMLTETGPDQPLGYQIRRYAIWQNITTVPPTR
DGKRTDLAAVSADRVADYREALEKSADLTLWQKIEQSLSVSPFWLDGHWLSARVATALGHHACAEAIRVS
AKEFVERLTQLPELTFNDGTPFLSCEAEEWLWSAPATSGSAGSANAWEQAYDKARDLVSQKELAAGMQLL
EDGLAEVREPRDRFYWRLASARLMKDAGLKSLAAQQVQDLQTQVRGLALEDWEPALIRQLEKLG
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3651095-3649641 Marinobacter adhaerens HP15 chromosome, complete genome
GTGATTCAGGACAGCAACATGCAGATCATTGAGCAACATCCCTACGTTGAACAGGTTGTCTCACCATTGC
CCGGCGATTCAGTTGTCGGCGAGGCACTCGGAGACGATGCAACGCTCGAGTTTCTGGAAAACGAGATCAT
GAAGGTGGGCTCTCTGGCCCATACCGATATTGATTGGAACAGGGTTGAAAGCGATGCCCTGACGATTCTC
TCGGACCGCAGCAAGGACCTGAAAGTTCTCGGCTTTTTGCTGATCGCTCTGCAGCGTGGCGGCGACGGTG
AACGGTTCGCCCTGTCTCTTTACCTGCTGCACCGGGTCCTGGATGAGTGGTGGGAGCAGGCCTGGCCGTA
TCCCGGGGACAAGGGCAAGCGGGCCCGCAAAATGATGTTCACTCAGATGCTCCAGCGCGCCAGCAAAGGC
GTAGACGCCCTGGCGTTCGATGGCAGCGTTGGCGACGGTCGGGCGTTCTGCCTTGAACTCCTGGCCAGAT
TGATGGACCAGGCCGCTGGCCGCGAGTTACCCGAGGAGTCACTGCAGGATCTTAAACGGGCGGTTGAAAA
GCTTCCCAGGGTTAACGACGCCACGGCAGCCCCCGAACCCCGTTCGCCGGCAGGATCGGTCAGCCAGGAT
TCGGGAACGGAAACACCAGAGCAGAAACCCGCATCGTCGAAACCTTCCCTGGGGGCACTCACCCTGGACC
CGGGCGATGAGCGAGCAACCCGGCAGAGTCTTCTGAAAGTCGCGGACATGCTCACCGAAACCGGGCCGGA
CCAGCCTCTGGGTTATCAGATTCGCCGTTACGCCATCTGGCAGAACATCACCACGGTACCGCCGACACGG
GATGGAAAGCGTACCGATCTTGCCGCCGTGAGTGCCGATCGTGTGGCCGACTATCGGGAAGCCCTGGAAA
AGTCCGCCGACCTGACGTTGTGGCAGAAAATCGAGCAGAGCTTGTCCGTCAGTCCGTTCTGGCTCGACGG
CCATTGGTTGAGTGCCCGGGTAGCGACAGCCCTGGGCCATCATGCTTGTGCTGAAGCCATCCGTGTGTCT
GCAAAGGAGTTTGTTGAGCGGCTTACCCAGTTGCCGGAGCTCACCTTCAACGATGGCACGCCGTTCCTCT
CCTGCGAGGCGGAAGAGTGGCTCTGGTCCGCGCCGGCGACCAGTGGTTCCGCCGGCAGCGCCAATGCCTG
GGAGCAGGCTTATGACAAAGCTCGGGATCTGGTTTCACAAAAGGAACTGGCTGCCGGGATGCAACTTCTG
GAGGACGGGCTGGCGGAAGTGAGAGAACCAAGAGACCGCTTTTACTGGCGTCTTGCCAGCGCCCGTTTAA
TGAAAGACGCAGGCCTTAAATCGTTGGCCGCGCAGCAGGTCCAGGATCTGCAAACGCAGGTTCGCGGGCT
GGCTCTCGAGGACTGGGAGCCAGCCCTGATCAGGCAGCTTGAAAAGCTGGGCTGA